SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000009083 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000009083
Domain Number 1 Region: 4-72
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000245
Family I set domains 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000009083   Gene: ENSNLEG00000007463   Transcript: ENSNLET00000009518
Sequence length 112
Comment pep:novel supercontig:Nleu1.0:GL397262.1:59409198:59413727:1 gene:ENSNLEG00000007463 transcript:ENSNLET00000009518 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGHQFVMLSCEWPGGEPPATLSWLDEQQQPLGGSSSSVAVHLLQAQEDLAGREFTCQGTH
LLRTPDPHCHLQLGSKGTNRGVPEKMLRHRQALKHQPPPQVWILHKKPWMLQ
Download sequence
Identical sequences ENSNLEP00000009083 XP_003253563.2.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]