SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000009084 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000009084
Domain Number 1 Region: 719-923
Classification Level Classification E-value
Superfamily Fibronectin type III 2.08e-35
Family Fibronectin type III 0.00000777
Further Details:      
 
Domain Number 2 Region: 303-397
Classification Level Classification E-value
Superfamily Immunoglobulin 4.46e-20
Family I set domains 0.0079
Further Details:      
 
Domain Number 3 Region: 404-517
Classification Level Classification E-value
Superfamily Immunoglobulin 6.51e-18
Family I set domains 0.024
Further Details:      
 
Domain Number 4 Region: 225-310
Classification Level Classification E-value
Superfamily Immunoglobulin 1.12e-16
Family I set domains 0.011
Further Details:      
 
Domain Number 5 Region: 572-673
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000000761
Family Fibronectin type III 0.0018
Further Details:      
 
Domain Number 6 Region: 28-114
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000381
Family I set domains 0.0092
Further Details:      
 
Domain Number 7 Region: 128-199
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000513
Family I set domains 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000009084   Gene: ENSNLEG00000007464   Transcript: ENSNLET00000009519
Sequence length 1160
Comment pep:known_by_projection supercontig:Nleu1.0:GL397262.1:59438383:59525396:-1 gene:ENSNLEG00000007464 transcript:ENSNLET00000009519 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHPDLGPLCTLLYVTLIILCSSVSSDLAPYFTSEPLSAVQKLGGPVVLHCSAKPVTTRIS
WLHNGKELDGNLEHIKVHQGTLTILSLNSSLLGYYQCLANNSVGAIVSDPATVSAAVLGD
FASSTKHVITAEEKSAGFIGCRVPESNPKAEVRYKIRGKWLKHSTENYLILPSGNLQILN
VSLEDKGSYKCAAYNPVTHQLKVEPIGRKLLVSRPSSDDFHILHPTHSQALAVLSHSPVT
LECVVSGVPAPQVYWLKDGQDIAPGSKWRRLYSHLATDSIDPADSGNYSCMVGNKSGDVK
YVTYMVNVLEHASISKGLQDQIVSLGATVHFTCDVRGNPAPNCTWFHNAQPIHPSPRHLT
AGNGLKISGVTVEDVGMYQCVADNGIGFMHSTGRLEIENDSGFKPVIITAPVSAKVADGD
FVTLSCNASGLPVPVIRWYDSHGLITSHPSQVLRSKSRKSQLSRPEGLNLEPVYFVMSQA
GASSLHIQAVSQEHAGKYICEATNEHGTTQAEASLMVVPFETNTKAETVTLPDAAQNDER
NKRDGLETGLLSSLPGKVHPSAVESAPEKNASGISVPDAPIILSPPQTHTPDTYNLVWRA
GKDGGLPINAYFVKYRKLDDGVGMVGSWHTVRVPGSENELHLAELEPSSLYEVLMVARSA
AGEGQPAMLTFRTSKEKTASSKNTQASSPPVGIPKYPIVSEAANNNFGVVLTDSSRHSGV
PEAPDRPTISTASETSVYVTWIPRANGGSPITAFKVEYKRMRTSNWLVAAEDIPPSKLSV
EVRSLEPGSTYKFRVIAINHYGESFRSSASRPYQVAGFPNRFSNRPITGPHIAYTEAVSD
TQIMLKWTYIPSSNNNTPIQGFYIYYRPTDSDNDSDYKRDVVEGSKQWHMIGHLQPETSY
DIKMQCFNEGGESEFSNVMICETKVKRVPGASEYPVKDLSTPPNSLGSGGNVGPATNPAR
SSDMLYLIVGCVLGVMVLILMVFIAMCLWKNRQQNTIQKYDPPGYLYQGSDINGQMVEYT
TLSGASQINGSVHGSFLTNGGLSSGYSHLRHKVPNGVNGIVNGSLNGGLSFGHTNSLTRT
HVDFEHPHHLVNGGGTYMAVPQIDPLECVNCRNCRNNNRYVNNVSAQAVVNKAYASFYFS
LQQRKFLEFYLGYKVQDLQS
Download sequence
Identical sequences ENSNLEP00000009084

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]