SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000009090 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000009090
Domain Number 1 Region: 61-203
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 7.19e-23
Family Toll/Interleukin receptor TIR domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000009090   Gene: ENSNLEG00000007469   Transcript: ENSNLET00000009525
Sequence length 205
Comment pep:known_by_projection supercontig:Nleu1.0:GL397262.1:59760854:59767596:1 gene:ENSNLEG00000007469 transcript:ENSNLET00000009525 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSATKTDWFRQTLLKKPKKRPDSPESASSDASQPTSQDSPLPPSLSSVTSPSLPPTHASD
SGSSRWSKDYDVCVCHSEEDLVAAQDLVSYLEGSTASLRCFLQLRDATPGGAIVSELCQA
LSSSHCRVLLITPGFLQDPWCKYQMLQALTEAPGAEGRTIPLLSGLSRAAYPPELRFMYY
VDGRGPDGGFRQVKEAVMRYLQTLS
Download sequence
Identical sequences ENSNLEP00000009090

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]