SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000009095 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000009095
Domain Number 1 Region: 128-232
Classification Level Classification E-value
Superfamily Immunoglobulin 1.71e-18
Family C1 set domains (antibody constant domain-like) 0.073
Further Details:      
 
Domain Number 2 Region: 316-404
Classification Level Classification E-value
Superfamily Immunoglobulin 7.69e-18
Family I set domains 0.019
Further Details:      
 
Domain Number 3 Region: 400-496
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000695
Family I set domains 0.032
Further Details:      
 
Domain Number 4 Region: 32-134
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000708
Family I set domains 0.048
Further Details:      
 
Domain Number 5 Region: 228-313
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000014
Family I set domains 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000009095   Gene: ENSNLEG00000007473   Transcript: ENSNLET00000009530
Sequence length 760
Comment pep:known_by_projection supercontig:Nleu1.0:GL397262.1:59909949:60047995:-1 gene:ENSNLEG00000007473 transcript:ENSNLET00000009530 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ELGLQKRGCCLVLGYMAKDKFRRMNEGQVYSFSQQPQDQVVVSGQPVTLLCAIPEYDGFV
LWIKDGLALGVGRDLSSYPQYLVVGNHLSGEHHLKILRAELQDDAVYECQAIQAAIRSRP
ARLTVLVPPDDPVILGGPVISLRAGDPLNLTCHADNAKPAASIIWLRKGEVINGATYSXT
LLRDGKRESIVSTLFISPGDVENGQSIVCRATNKAIPGGKETSVIIDIQHPPLVNLSVEP
QPVLEDNVVTFHCSAKANPAVTQYRWAKRGQIIKEASGEVYRTTVDYTYFSEPVSCEVTN
ALGSTNLSRTVDVYFGPRMTTEPQSLLVDLGSDAIFSCAWTGNPSLTIVWMKRGSGVVLS
NEKTLTLKSVRQEDAGKYVCRAVVPRVGAGEREVTLTVNGPPIISSTQTQHALHGEKGQI
KCFIRSTPPPDRIAWSWKENVLESGTSGRYTVETISTEEGVISTLTISNIVRADFQTIYN
CTAWNSFGSDTEIIRLKEQGESCQGREGMMNESVPMAVIIGVAVGAGVAFLVLMATIVAF
CCARSQRNLKGVVSAKNDIRVEIVHKEPASGREAEEHSTIKQLMMDRGEFQQDSVLKQLE
VLKEEEKEFQNLKDPTNGYYSVNTFKEHHSTPTISLSSCQPDLRPAGKQRVPTGMSFTNI
YSTLSGQGRLYDYGQRFVLGMGSSSIELCEREFQRGSLSDSSSFLDTQCDSSVSSSGKQD
GYVQFDKASKASASSSHHSQSSSQNSDPSRPLQRRMQTHV
Download sequence
Identical sequences ENSNLEP00000009095 ENSNLEP00000009095

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]