SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000009112 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000009112
Domain Number 1 Region: 338-528
Classification Level Classification E-value
Superfamily CAPPD, an extracellular domain of amyloid beta A4 protein 9.68e-80
Family CAPPD, an extracellular domain of amyloid beta A4 protein 0.000000118
Further Details:      
 
Domain Number 2 Region: 12-104
Classification Level Classification E-value
Superfamily A heparin-binding domain 5.23e-41
Family A heparin-binding domain 0.00000661
Further Details:      
 
Domain Number 3 Region: 105-169
Classification Level Classification E-value
Superfamily Amyloid beta a4 protein copper binding domain (domain 2) 2.62e-28
Family Amyloid beta a4 protein copper binding domain (domain 2) 0.0000574
Further Details:      
 
Domain Number 4 Region: 270-328
Classification Level Classification E-value
Superfamily BPTI-like 1.56e-21
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.00035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000009112   Gene: ENSNLEG00000007489   Transcript: ENSNLET00000009548
Sequence length 715
Comment pep:known_by_projection supercontig:Nleu1.0:GL397262.1:63710422:63757286:1 gene:ENSNLEG00000007489 transcript:ENSNLET00000009548 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ALAANAGTGFAVAEPQIAMFCGKLNMHVNIQTGKWEPDPTGTKSCFETKEEVLQYCQEMY
PELQITNVMEANQRVSIDNWCRRDKKQCKSRFVTPFKCLVGEFVSDVLLVPEKCQFFHKE
RMEVCENHQHWHTVVKEACLTQGMTLYSYGMLLPCGVDQFHGTEYVCCPETKITGSVSKE
EEEEEEEEDEEEEEDEEEDYDVYKSRFAFCCETKELLYVNLNSHLDSRGCQKIFIPVPKC
LCGEATSFGQPGPPGSVQSQASPSPSPGLLASVCSQEAMTGPCRAVMPRWYFDLSKGKCV
RFIYGGCGGNRNNFESEDYCMAVCKAMIPPTPLPTNDVDVYFETSADDNEHARFQKAKEQ
LEIRHRNRMDRVKKEWEEAELQAKNLPKAERQTLIQHFQAMVKALEKEAASEKQQLVETH
LARVEAMLNDRRRMALENYLAALQSDPPRPHRILQALRRYVRAENKDRLHTIRHYQHVLA
VDPEKAAQMRSQVMTHLHVIEERRNQSLSLLYKVPYVAQEIQEEIDELLQEQRADMDQFT
ASISETPVDVRVSSEESEEIPPFHPFHPFPALPENEGSGVGEQDGGLIGAEEKVINSKNK
VDENMVIDETLDVKEMIFNAERVGGLEEERESVGPLREDFSLSSSALIGLLVIAVAIATV
IVISLVMLRKRQYGTISHGIVEVDPMLTPEERHLNKMQNHGYENPTYKYLEQMQI
Download sequence
Identical sequences ENSNLEP00000009112

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]