SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000009296 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000009296
Domain Number 1 Region: 232-319
Classification Level Classification E-value
Superfamily Immunoglobulin 5.23e-18
Family I set domains 0.045
Further Details:      
 
Domain Number 2 Region: 1078-1144,1188-1252
Classification Level Classification E-value
Superfamily Immunoglobulin 3.87e-17
Family I set domains 0.074
Further Details:      
 
Domain Number 3 Region: 514-573,622-702
Classification Level Classification E-value
Superfamily Immunoglobulin 3.96e-17
Family I set domains 0.034
Further Details:      
 
Domain Number 4 Region: 327-413
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000236
Family I set domains 0.046
Further Details:      
 
Domain Number 5 Region: 891-976
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000129
Family I set domains 0.043
Further Details:      
 
Domain Number 6 Region: 1448-1506,1549-1625
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000017
Family I set domains 0.033
Further Details:      
 
Domain Number 7 Region: 1262-1319,1362-1438
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000393
Family I set domains 0.019
Further Details:      
 
Domain Number 8 Region: 32-134
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000166
Family V set domains (antibody variable domain-like) 0.0000151
Further Details:      
 
Domain Number 9 Region: 404-502
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000665
Family I set domains 0.042
Further Details:      
 
Domain Number 10 Region: 790-893
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000684
Family I set domains 0.042
Further Details:      
 
Domain Number 11 Region: 137-236
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000101
Family V set domains (antibody variable domain-like) 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000009296   Gene: ENSNLEG00000007641   Transcript: ENSNLET00000009741
Sequence length 1704
Comment pep:known_by_projection supercontig:Nleu1.0:GL397425.1:839719:858805:-1 gene:ENSNLEG00000007641 transcript:ENSNLET00000009741 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGFLPKLLLLASFFPAGQASWGVSSPQDVQGVKGSCLIPCIFSFPADVEVDGITTIWYYD
YSGRRQVASHSADPKLVEARFRGRAEFMGNPEHKVCNLLLKDLQPEDSGSYNFRFEISEV
NRWSDVKGTLVTVTEEPRVPTIAAPVELLEGTEVDFNCSTPYACLQEQVRLQWQGQDPAR
SVTFNSQKFEPTSVSHLETLHMAMSWQDHGRILRCQLSVANHRAHSEIHLQVKYAPKGVK
ILLSPSGRNILPGEPVTLTCQVNSSYPAVSSIKWLKDGVRLQTKTGVLHLPQAAWSDAGV
YTCQAENGVGSLVSPPISLHIFMAEVQVSPTGPILENQTVTLVCNTPSGAPSDLRYSWYK
NHVLLEDAHSHTLLLHSATRADTGFYFCEVQNAHGSERSGPVSVVVNHPPLTPVLTAFLE
TQAGLVGILHCSVVSEPLATLVLSHGGHILASTSGDSDHSPRFSGTSGPNSLRLEIRELE
EADSGEYKCSATNSLGNATSTLDFHGNAARLLISPAAEVVEGQPVTLSCRSGLSPTPDAR
FSWYLNGALLHEGPSSSLLLPAASSTDAGSYHCRARDSHSASGPSSPAILTVLYPPRQPT
FTTRLDLDAAGAGAGRRGLLLCRVDSDPPARLQLFHKDRVVATSLPSGGGCSTCGGCFPR
IKVTKAPNLLHVEIHNPLLEEEGLYLCEASNALGNASASATFNGQGEKIRAAPSHDLCSG
WGQASQLVPEEGLPSWDSWAAFSQGPLLLGCPVSWLAFLPNPVSTPGGLLPVPSRLGGWT
PGSWGLGVVNPPDPPKLSALLDMGQGHMALFVCTVDSRPLALLALFHGEHLLATSLGPQV
PSHSRLQAKAEANSLKLEVRELGLGDSGSYRCEATNVLGSSNTSLFFQVRGAWVQVSPSP
ELQEGQAVVLSCQVPTGVPEGTSYRWYRDGQPLQESTSATLRFAAITLTQAGAYHCQAQA
PGSATTSLAAPISLRVSWKDFCPIHFLGRTFFKHQILHVCPVDKTKQGISRESAAGEGRS
VVSPFAPIQGQGGAQGFPRLVELYLGPLRSHSRGSLPTWRQVACCTQPQDPHWCPVPSLS
PAVNVQVWPGATVQEGQLVNLTCVWTTHPAQLTYTWYQDGQQRLDAHSIPLPNVTVRDAT
SYRCGVGPPGQAPRLSRPITLDVLYAPRNLRLTYLLESHGGQLALVLCTVDSRPPAQLAL
SHAGRLLASSTAASVPNTLRLELREPQPSDEGFYSCSARSPLGQANTSLELRLEGVRVIL
APEATVPEGAPITVTCEDPAAHPPTLYTWYHNGRWLQEGPAASLSFPVATRAHAGAYSCQ
AQDAQGTRSSRPAALQVLYAPQDAVLSSFRDSRARSMAVIQCTVDSEPPAELALSHDGKV
LATSSGVHSLASGTSHVQVARNALRLQVQDVPAGDATYVCTAQNLLGSISTIGRLQVEGA
RVVADPGLDVPEGAALNLSCRLLGGPGPVGNSTFAWFWNDRRLYTEPVPTLAFTHVARAQ
AGMYHCLAELPTGAAASAPVMLRVLYPPKTPIMMVFVEPEGGLRGILDCRVDSEPLASLS
LHLGSRLVASSQPQGAPAEPHIHILASPNALRVDIEALRPSDQGEYVCSASNALGSASTS
TYFGVRALHRLHQFQQLLWVLGLLVGLLLLLLGLGACYTWRRRRVCKQSMGENSVEMALQ
KETTQLIDPDAATCETSSCAPPLG
Download sequence
Identical sequences ENSNLEP00000009296 ENSNLEP00000009296

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]