SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000009328 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSNLEP00000009328
Domain Number - Region: 128-195
Classification Level Classification E-value
Superfamily C-type lectin-like 0.000443
Family Link domain 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000009328   Gene: ENSNLEG00000007659   Transcript: ENSNLET00000009775
Sequence length 931
Comment pep:known_by_projection supercontig:Nleu1.0:GL397373.1:5396767:5449796:1 gene:ENSNLEG00000007659 transcript:ENSNLET00000009775 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAARDSDSEEDLVSYGTGLEPLEEGERPKKPIPLQDQTVRDEKGRYKRFHGAFSGGFSAG
YFNTVGSKEGWTPSTFVSSRQNRADKSVLGPEDFMDEEDLSEFGIAPKAIVTTDDFASKT
KDRIREKARQLAAATAPIPGATLLDDLITPAKLSVGFELLRKMGWKEGQGVGPRVKRRPR
RQKPDPGVKIYGCALPPGSSEGSEGEDDDYLPDNVTFAPKDVTPVDFTPKDNVHGLAYKG
LDPHQALFGTSGEHFNLFSGGSERAGDLGEIGLNKGRKLGISGQAFGVGALEEEDDDIYA
TETLSKYDTVLKDEEPGDGLYGWTAPRQYKNQKESEKDLRYIGKILDGFSLASKPLSSKK
IYPPPELPRDYRPVHYFRPMVAATSGNTHLLQVLSESAGKATPDPGTHSKHQLNASKRAE
LLGETPIQGSATSVLEFLSQKDKERIKEMKQATDLKAAQLKARSLAQNAQSSRAQPSPAA
AAGHWSWHTALGGGTATLKASNFKPFAKDPEKQKRYEEFLVHMKQGQKDALERCLDPSMT
EWERGRERDEFARAALLYASSHSTLSSRFTHAKEEDDSDQVEVPRDQENDVGDKQSAVKM
KMFGKLTRDTFEWHPDKLLCKRFNVPDPYPDSTLVGLPRVKRDKYSVFNFLTLPETASLP
TTQASSEKVSQHRGPDKSGKPSRWDTSKHEKKEDSISEFLSLARSKAGPPKQESSPLVNK
EEKRAPESSANQTVNKGVDAQAEGEGSRPSMDLFRAIFASSSDEKSSSSEDEQDDSEDDQ
AGSGEAKFQSSQDTDLGETSSVAHALVPAPQEPPPSFLIQKMQIDEKEEFGPRLPPVFCP
NARQTLEVPQKEKHKKNKDKHKAKKEHRRKKEKKKKHRKHKHKGKQKNKKPEKNSSSESS
DSSDSQSDEETADVSPQELLRRLKSLPLRRQ
Download sequence
Identical sequences G1R7Z8
XP_003275103.1.23891 ENSNLEP00000009328 ENSNLEP00000009328

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]