SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000009349 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000009349
Domain Number 1 Region: 2-180
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.51e-67
Family Myotubularin-like phosphatases 0.00000665
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000009349   Gene: ENSNLEG00000007690   Transcript: ENSNLET00000009796
Sequence length 226
Comment pep:known_by_projection contig::ADFV01134780.1:80861:90446:-1 gene:ENSNLEG00000007690 transcript:ENSNLET00000009796 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
REGASILIHGTEGTDSTLQVTSLAQIILEPRSRTIRGFEALIEREWLQAGHPFQQRCAQS
AYCNTKQKWEAPVFLLFLDCVWQILRQFPCSFEFNENFLIMLFEHAYASQFGTFLGNNES
ERCKLKLQQKTMSLWSWVNQPSGLSKFTNPLFEANNLVIWPSVAPQSLPLWEGIFLRWNR
SSKYLDEAYEEMVNIIEYNKELQAKVNILRRQLAELETEDGMQESP
Download sequence
Identical sequences ENSNLEP00000009349 ENSNLEP00000009349

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]