SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000009361 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000009361
Domain Number 1 Region: 24-266,307-381,528-577
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.56e-64
Family FAD-linked reductases, N-terminal domain 0.0017
Further Details:      
 
Domain Number 2 Region: 361-484
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 5.04e-31
Family L-aminoacid/polyamine oxidase 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000009361   Gene: ENSNLEG00000007689   Transcript: ENSNLET00000009810
Sequence length 585
Comment pep:known_by_projection supercontig:Nleu1.0:GL397425.1:1341860:1354018:1 gene:ENSNLEG00000007689 transcript:ENSNLET00000009810 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQSCESSGDSADDPLSRGLRRRGQPRVVVIGAGLAGLAAAKALLEQGFTDVTVLEASSHI
GGRVQSVKLGHATFELGATWIHGSHGNPIYHLAEANGLLEETTDGERSVGRISLYSKNGV
ACYLTNHGRRIPKDVVEEFSDLYNEVYNLTQEFFRHDKPVNAESQNSVGVFTREEVRNRI
RNDPDDPEATKRLKLAMIQQYLKVESCESSSHSMDEVSLSAFGEWTEIPGAHHIIPSGFM
RVVELLAEGIPAHVIQLGKPVRCIHWDQASARPRGPEIEPRGEGDHNHDTGEGGQGGEDP
RGGRWDEDEQWPVVVECEDCELIPADHVIVTVSLGVLKRQYTSFFRPGLPTEKVAAIHRL
GIGTTDKIFLEFEEPFWGPECNSLQFVWEDEAESHTLTYPPELWYRKICGFDVLYPPERY
GHVLSGWICGEEALVMEKCDDEAVAEICTEMLRQFTGNPNIPKPRRILRSAWGSNPYFRG
SYSYTQVGSSGADVEKLAKPLPYTESSKTAHGSSTKQQPGHLFSSKCPEQPLDANRGAVK
PMQVLFSGEATHRKYYSTTHGALLSGQREAARLIEMYRDLFQQGT
Download sequence
Identical sequences A0A2I3HMX4
XP_012367165.1.23891 ENSNLEP00000009361 ENSNLEP00000009361

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]