SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000009392 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000009392
Domain Number 1 Region: 662-965
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.05e-82
Family Protein kinases, catalytic subunit 0.000000000115
Further Details:      
 
Domain Number 2 Region: 85-256
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 8.08e-67
Family Ephrin receptor ligand binding domain 0.00000881
Further Details:      
 
Domain Number 3 Region: 385-584
Classification Level Classification E-value
Superfamily Fibronectin type III 1.3e-30
Family Fibronectin type III 0.0018
Further Details:      
 
Domain Number 4 Region: 954-1024
Classification Level Classification E-value
Superfamily SAM/Pointed domain 9.42e-19
Family SAM (sterile alpha motif) domain 0.00096
Further Details:      
 
Domain Number 5 Region: 316-387,423-438
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000698
Family Growth factor receptor domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000009392   Gene: ENSNLEG00000007722   Transcript: ENSNLET00000009841
Sequence length 1033
Comment pep:known_by_projection supercontig:Nleu1.0:GL397476.1:1646079:1679452:-1 gene:ENSNLEG00000007722 transcript:ENSNLET00000009841 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNEQESVLTQLPLRTRGRRGRSCARAGGRERTSRPACRRAGVREPGSGDRTESEKRGMEL
QAARACFALLWGCALAAAAAAQGKEVVLLDFAAAGGELGWLTHPYGKGWDLMQNIMNDMP
IYMYSVCNVMSGDQDNWLRTNWVYRGEAERIFIELKFTVRDCNSFPGGASSCKETFNLYY
AESDLDYGTNFQKRLFTKIDTIAPDEITVSSDFEARHVKLNVEERSVGPLTRKGFYLAFQ
DIGACVALLSVRVYYKKCPELLQGLAHFPETIAGSDAPSLATVAGTCVDHAVVPPGGEEP
RMHCAVDGEWLVPIGQCLCQAGYEKVEDACQACSPGFFKFEASESPCLECPEHTLPSPEG
ATSCECEEGFFRAPQDPVSMPCTRPPSAPHYLTAVGMGAKVELRWTPPQDSGGREDIVYS
VTCEQCWPESGECGPCEASVRYSEPPQGLTRTSVTVSDLEPHMNYSFTVEARNGVSGLVT
SRSFRTASVSINQTEPPKVRLEGRSTTSLSVSWSIPLPQQSRVWKYEVTYRKKGDSNSYN
VRRTEGFSVTLDDLAPDTTYLVQVQALTQEGQGAGSKVHEFQTLSPEGSGNLAVIGGVAV
GGVLLLVLAGVGFFIHRRRKKLRARQSPEDVYFSKSEQLKPLKTYVDPHTYEDPNQAVLK
FTTEIHPSCVTRQKVIGAGEFGEVYKGTLKTSSGKKEVPVAIKTLKAGYTEKQRVDFLGE
AGIMGQFSHHNIIRLEGVVSKYKPMMIITEYMENGALDKFLREKDGEFSVLQLVGMLRGI
AAGMKYLANMNYVHRDLAARNILVNSNLVCKVSDFGLSRVLEDDPEATYTTSGGKIPIRW
TAPEAISYRKFTSASDVWSFGIVMWEVMTYGERPYWELSNHEVMKAINDGFRLPTPMDCP
SAIYQLMMQCWQQERARRPKFADIVSILDKLIRAPDSLKTLADFDPRVSIRLPSTSGSEG
VPFRTVSEWLESIKMQQYTEHFMAAGYTAIEKVVQMTNDDIKRIGVRLPGHQKRIAYSLL
GLKDQVNTVGIPI
Download sequence
Identical sequences ENSNLEP00000009392

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]