SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000009400 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000009400
Domain Number 1 Region: 341-452
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.84e-20
Family Spermadhesin, CUB domain 0.003
Further Details:      
 
Domain Number 2 Region: 636-693
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000324
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 3 Region: 762-821
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000102
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 4 Region: 173-278
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000000419
Family Spermadhesin, CUB domain 0.0035
Further Details:      
 
Domain Number 5 Region: 282-343
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000278
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 6 Region: 518-605
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000000000445
Family Spermadhesin, CUB domain 0.0044
Further Details:      
 
Domain Number 7 Region: 457-521
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000834
Family Complement control module/SCR domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000009400   Gene: ENSNLEG00000007728   Transcript: ENSNLET00000009849
Sequence length 903
Comment pep:known_by_projection supercontig:Nleu1.0:GL397419.1:1560281:1658912:1 gene:ENSNLEG00000007728 transcript:ENSNLET00000009849 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PKHTLPPKKKLPSLKQVNFARKQLRPKATSAATVQRAGSQPASQGLDLLSSSTEKPGPPG
DPDPVVASEEASEVPLWLDRKESAVPTTPAPLQISPFTSQPYVAHTLPQRPEPGEPGPDM
AQEAPQEDTSPMALMDKGENELTGSASEESQETTTSTIITTTVITTEQAPALCSVSFSNP
EGYIDSSDYPLLPLNNFLECTYNVTVYTGYGVELQVKSVNLSDGELLSIRGVDGPTLTVL
TNQTLLVGQVIRPTNTISVYFRTFQDDGLGNFQLHYQAFMLSCNFPRRPDSGDVTVMDLH
SGGVAHFHCHLGYELQGAKMLTCINASKPHWSSQEPICSAPCGGAVHNATIGRVLSPSYP
ENTNGSQFCVWTIEAPEGQKLHLHFERLLLHDKDRMTVHSGQTNKSALLYDSLQTESVPF
EGLLSEGNTIRIEFTSDQARAASTFNIRFEAFEKGHCYEPYIQNGNFTTSDPTYNIGTIV
EFTCDPGHSLEQGPAIIECINVRDPYWNDTEPLCRAMCGGELSAVAGVVLSPNWPEPYVE
GEDCIWKIHVGEEKRIFLDIQFKQFSYLSLPSSWDYKHMPPRPAYFYSGNTDHIPTVISD
GMLTVNICFYSPCSAQRQAGSPSLILSFLLVSRNDSCSDLPEIQNGWKTTSHTELVRGAR
ITYQCDPGYDIVGSDTLTCQWDLSWSSDPPFCEKSKSCSEPGCTTALQPGCLRLLGTFTV
QYSTVHAVLEKLRRLTTQSSHDGCAEHTELLLACISAEESLACDNPGLPENGYQILYKRL
YLPGESLTFMCYEGFELMGEVTIRCILGQPSHWNGPLPVCKVAEAAAETSLEGGNMALAI
FIPVLIISLLLGGAYIYITRCRYYSNLRLPLMYSHPYSQITVETEFDNPIYETGETREYE
VSI
Download sequence
Identical sequences ENSNLEP00000009400 ENSNLEP00000009400

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]