SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000009418 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000009418
Domain Number 1 Region: 33-128
Classification Level Classification E-value
Superfamily Immunoglobulin 4.68e-26
Family I set domains 0.00023
Further Details:      
 
Domain Number 2 Region: 483-578
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000608
Family I set domains 0.02
Further Details:      
 
Domain Number 3 Region: 315-392,437-489
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000291
Family I set domains 0.0048
Further Details:      
 
Domain Number 4 Region: 129-211
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000101
Family C2 set domains 0.00067
Further Details:      
 
Domain Number 5 Region: 222-288
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000365
Family I set domains 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000009418   Gene: ENSNLEG00000007747   Transcript: ENSNLET00000009867
Sequence length 582
Comment pep:known_by_projection supercontig:Nleu1.0:GL403833.1:4:5121:1 gene:ENSNLEG00000007747 transcript:ENSNLET00000009867 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SHFSCRAELDLRPHGLGLFENSSAPRELRTFSLSPDPPRLAAPRLLEVGSERPVSCALDG
LFPASEARVYLALGDQNLSPDVTLEGDAFVATATATASAEQEGARQLVCNVTLGGENRET
RENVTIYSFPAPLLTLSEPSVSEGQMVTVTCAAGAQALVTLEGVPAAVPGQPAQLKLNAT
ENDDRRSFFCDATLDVDGETLIKNRSAELRVLYAPRLDDSDCPRSWTWPEGPEQTLRCEA
RGNPEPSVHCARSDGGAVLALGLLGPVTRALSTYRCKAANDQGEAVRTRGTAELGRICGT
TPAGLPGPRVSPCNPVSQGPRFEEPSCPSNWTWVEGSGRLFSCEVDGKPQPSVKCVGSGG
ATEGVLLPLAPPDPSPRAPRIPRVLAPGIYVCNATNRHGSVAKTVVVSAESPPEMDESTC
PSHQTWLEGAEASALACAARGRPSPGVRCSREGIPWPEQQRVSREDAGTYHCVATNAHGT
DSRTVTVGVEYRPVVAELAASPPGGVRPGGNFTLTCRAEAWPPAQISWRAPPGALNIGLS
SNNSTLSVAGAMGSHGGEYECAATNAHGRHARRITVRVAGKW
Download sequence
Identical sequences ENSNLEP00000009418 ENSNLEP00000009418

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]