SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000009456 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000009456
Domain Number 1 Region: 37-146
Classification Level Classification E-value
Superfamily Immunoglobulin 2.14e-18
Family V set domains (antibody variable domain-like) 0.0000455
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000009456   Gene: ENSNLEG00000007780   Transcript: ENSNLET00000009910
Sequence length 288
Comment pep:known_by_projection supercontig:Nleu1.0:GL397601.1:319004:328555:-1 gene:ENSNLEG00000007780 transcript:ENSNLET00000009910 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQIPQAPWPVIWAVLQLGWRPGWFLDSPDRPWNPPTFSPALLVVTEGDNATFTCSFSNAS
ESFVLNWYRMSPSNQTDKLAAFPEDRSQPGQDHRFRVTQLPNGRDFHMSVVRAQHNDSGT
YLCGAISLAPKAQIKESLRAELRVTERRAEVPTAHPSPSPRPAGQFQALVVGVVGGLLGS
LVLLVWVLAVICSRATRGTIGARRTGQPLKEDPSAVPVFSVDYGELDFQWREKTPEPPVP
CVPEQTEYATIVFPSGMGTSSPARRGSADGPRSPQPLRPEDGHCSWPL
Download sequence
Identical sequences G1R8C2
ENSNLEP00000009456 ENSNLEP00000009456 XP_003282018.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]