SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000009459 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000009459
Domain Number 1 Region: 22-121
Classification Level Classification E-value
Superfamily Immunoglobulin 5.38e-38
Family V set domains (antibody variable domain-like) 0.0000325
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000009459   Gene: ENSNLEG00000007793   Transcript: ENSNLET00000009913
Sequence length 129
Comment pep:novel supercontig:Nleu1.0:GL397431.1:79894:81135:1 gene:ENSNLEG00000007793 transcript:ENSNLET00000009913 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAPAQLLFLLLLWLPDTTGEIVLTQSPATLSLSTRERATISCTASQSVSSYLAWYQQKP
GQAPRLLIYYASSRATGIPDRFSGSGSGTDFTLTISSLEPEDFAVYYCQQYKSFSPTVIQ
HETKTSTRP
Download sequence
Identical sequences ENSNLEP00000009459

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]