SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000009481 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000009481
Domain Number 1 Region: 8-79
Classification Level Classification E-value
Superfamily RING/U-box 4.42e-16
Family RING finger domain, C3HC4 0.016
Further Details:      
 
Domain Number 2 Region: 86-148
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000000183
Family B-box zinc-binding domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000009481   Gene: ENSNLEG00000007798   Transcript: ENSNLET00000009936
Sequence length 208
Comment pep:novel supercontig:Nleu1.0:GL397431.1:1098365:1102789:1 gene:ENSNLEG00000007798 transcript:ENSNLET00000009936 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNSGISQVFQRERTCPICMNYFIDPVTIDCGHSFCRPCFYLSWQDIPILTRCFECIKTTQ
QRNLKTSIRWKKMASLARKASLWLFLSSEEQMCGTHRETKKMFCEVGKSLLCSLCSSSQE
HRDHRHCPIEWAAEEHREKLLKKMQSLWEKACENQRNLNVATTRISHWKAFGDILYRSEC
VLLHMPQPLNLELRAGPITRLRDRPNKF
Download sequence
Identical sequences ENSNLEP00000009481 ENSNLEP00000009481

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]