SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000009488 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000009488
Domain Number 1 Region: 36-132
Classification Level Classification E-value
Superfamily Immunoglobulin 5.47e-26
Family I set domains 0.011
Further Details:      
 
Domain Number 2 Region: 122-216
Classification Level Classification E-value
Superfamily Immunoglobulin 1.49e-20
Family I set domains 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000009488   Gene: ENSNLEG00000007801   Transcript: ENSNLET00000009943
Sequence length 219
Comment pep:novel contig::ADFV01145679.1:59:5444:1 gene:ENSNLEG00000007801 transcript:ENSNLET00000009943 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RISQFPGEGEGSRSLCPPDNHRGHLLWLTPAPLPTVPPQIASSAPTVRVLEGQPVSLPCI
VLAGRPLPERHWLKDGQPLPPGSRHSIRADGSLHLDQALQEHAGRYSCVATNTAGSQHRD
VELVVQVPPRIHPTATHHITNEGVPASLPCVASGVPTPTITWTKETNALTSRGPHYNVSK
EGTLLIAQPSAQDAGAYVCTATNTVGFSSQEMRLSVNSE
Download sequence
Identical sequences ENSNLEP00000009488

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]