SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000009499 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000009499
Domain Number 1 Region: 13-124
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000242
Family V set domains (antibody variable domain-like) 0.03
Further Details:      
 
Domain Number 2 Region: 327-416
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000695
Family I set domains 0.0066
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000009499
Domain Number - Region: 262-320
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000119
Family C1 set domains (antibody constant domain-like) 0.031
Further Details:      
 
Domain Number - Region: 134-175
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0312
Family V set domains (antibody variable domain-like) 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000009499   Gene: ENSNLEG00000007805   Transcript: ENSNLET00000009954
Sequence length 445
Comment pep:known_by_projection supercontig:Nleu1.0:GL397462.1:1085876:1240740:1 gene:ENSNLEG00000007805 transcript:ENSNLET00000009954 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GYLTVNIEPLPPVVAGDAVTLKCNFKTDGRMREIVWYRVTDGGTIKQKIFTFDAMFSTNY
SHMENYRKREDLVYQSTVRLPEVRISDNGPYECHVGIYDRATREKVVLASGNIFLNVMGE
PTPMIHFCLSVPAPRGGAYRGRQASLSCAVSGAEIGAQVYFKRDGEPIDAVPLSEPPAAS
SGPLQDSRPFRSLLHRDLDDTKMQKSLSLLDTENRGGRPYTERPSRGLTPDPNILLQPTT
ENIPETVVSREFPRWVHSAEPTYFLRHSRTPSSDGTVEVRALLTWTLNPQIDNEALFSCE
VKHPALSMPMQAEVTLVAPKGPKIVMTPSRARVGDTVRILVHGFQNEVFPEPMFTWTRVG
SRLLDGSAEFDGKELVLERVPAELNGSMYRCTAQNPLGSTDTHTRLIVFENPNIPRGTED
SNGSIGPTGARLTLVLALTVILELT
Download sequence
Identical sequences ENSNLEP00000009499 ENSNLEP00000009499

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]