SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000009517 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSNLEP00000009517
Domain Number - Region: 122-146
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00262
Family CCCH zinc finger 0.0032
Further Details:      
 
Domain Number - Region: 157-180
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0353
Family CCCH zinc finger 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000009517   Gene: ENSNLEG00000007827   Transcript: ENSNLET00000009973
Sequence length 307
Comment pep:known_by_projection supercontig:Nleu1.0:GL397455.1:3507:64564:1 gene:ENSNLEG00000007827 transcript:ENSNLET00000009973 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LQGRCSRENCKYLHPPTHLKTQLEINGRNNLIQQKTAAAMLAQQMQFMFPGTPLHPVPTF
PVGPAIGTNTAISFAPYLAPVTPGVGLVPTEILPTTPVIVPGSPPVTVPGSTATQKLLRT
DKLEVCREFQRGNCARGETDCRFAHPADSTMIDTSDNTVTVCMDYIKGRCMREKCKYFHP
PAHLQAKIKAAQHQANQAAVAAQAAAAAATVMAFPPGALHPLPKRQALEKSNGTSAVFNP
SVLHYQQALTSAQLQQHAAFIPTGSVLCMTPATSIVPMMHSATSATVSAATTPATSVPFA
ATATANQ
Download sequence
Identical sequences ENSNLEP00000009517

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]