SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000009544 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000009544
Domain Number 1 Region: 254-304
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000196
Family RING finger domain, C3HC4 0.023
Further Details:      
 
Domain Number 2 Region: 187-222
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00000000222
Family CCCH zinc finger 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000009544   Gene: ENSNLEG00000007844   Transcript: ENSNLET00000010001
Sequence length 322
Comment pep:known_by_projection supercontig:Nleu1.0:GL397455.1:930123:931482:-1 gene:ENSNLEG00000007844 transcript:ENSNLET00000010001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAPPSPGRTADQADQVCTFLFKKPGRKGAAGLRKRPACDPEHGESSSSGDEGDAVARPP
RVEPRPRGLHSWRKAAHGDRRCEEAAPEGLGVVYRSTRSAKPVGPEDMGATADFKQDTEK
EHHTQTIFKRSQRVQEALRGREHDHIYRGIHSYPRYLTPKDTSMGNSSSGMARSGPIRAP
GHLRATVRWDYQPDICKDYKETGFCGFGDSCKFLHDRSDYKHGWEIERELEEGRYGICED
ENHEAGSEEEEIPLRCFICRQAFQNPVITKCRHYFCESCALEHFRATPRCYVCDQPTGGI
FNPAKELMAKLQKLRAAERKKG
Download sequence
Identical sequences G1R8K7
ENSNLEP00000009544 ENSNLEP00000009544

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]