SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000009554 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000009554
Domain Number 1 Region: 287-380
Classification Level Classification E-value
Superfamily Subtilisin-like 0.00000000000111
Family Subtilases 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000009554   Gene: ENSNLEG00000007850   Transcript: ENSNLET00000010012
Sequence length 1132
Comment pep:known_by_projection supercontig:Nleu1.0:GL397328.1:3330610:3405939:1 gene:ENSNLEG00000007850 transcript:ENSNLET00000010012 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IPASWTNPSGKYHIGIKNGYDFYPKALKERIQKERKEKIWDPVHRVALAEACRKQEEFDV
ANNGSSQANKLIKEELQSQVELLNSFEKKYSNPGPVYDCLVWHDGEVWRACIDSNEDGDL
SKSTVLRNYKEAQEYGSFGTAEMLNYSVNIYDDGNLLSIVTSGGIPFQIPMRYIYEVIKW
YIAIAHSNLLENFKLEILAKGVQNHKCDLIYLQDHGPTSENPSIGQVQWLMPVILAPWEA
EVGRSPEAGMQLVHSVILLDLISGRLKNAYVCLAFTILSKLQWLSVSADGALGVSISAGG
AIASIPNWTLRGTQLMNGTSMSSPNACGGIALILSGLKANNIDYTVHSVRRALENTAVKA
DNIEVFAQGHGIIQVDRAYDYLVQNTSFANKLGFTVTVGNNRGIYLRDPVQVAAPSDHGV
GIEPVFPENTENSEKISLQLHLALTSNSSWVQCPSHLELMNQCRHINIRVDPRGLREGLH
YTEVCGYDIASPNAGPLFRVPITAVIAAKVNESSHYDLAFTDVHFKPGQIRRHFIEVPEG
ATWAEVTVCSCSSEVSAKFVLHAVQLVKQRAYRSHEFYKFCSLPEKGTLTEAFPVLGGKA
IEFCIARWWASLSDVNIDYTISFHGIVCTAPQLNIPASEGINCFDVQSSLKYEDLAPCIT
LKNWVQTLRPVSAKTKPLGSRDVLPNNRQLYEMVLTYNFHQPKSGEVTPSCPLLCELLYE
SEFDSQLWIIFDQNKRQMGSGDAYPHQYSLKLEKGDYTVRLQIRHEQISDLERLKDLFIV
SHRLSNTLSLDIHENHSFALLGKKKSNNLTLPPKYNQPFFVTSLPDDKIPKGAGPGCYLA
GSLTLSKTELEKKAGQSAAKRQGKFKKDVIPVHYYLIPPPTKTKNGSKDKEKDSEKEKDL
KEEFTEALRDLKIQWMTKLDSSDIYNELKETYPNYLPLYVARLHQLDAEKERMKRLNEIV
DAANAVISHIDQTALAVYIAMKTDPRPDAATIKNDMDKQKSTLVDALCRKGCALADHLLH
TQAQDGAISTDAEGKEEEGESPLDSLAETFWETTKWTDLFDNKVLTFAYKHALVNKMYGR
GLKFATKLVEEKPTKENWKNCIQLMKLLGWTHCASFTENWLPIMYPPDYCVF
Download sequence
Identical sequences ENSNLEP00000009554 ENSNLEP00000009554

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]