SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000009644 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000009644
Domain Number 1 Region: 244-381
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000136
Family Growth factor receptor domain 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000009644   Gene: ENSNLEG00000007911   Transcript: ENSNLET00000010105
Sequence length 869
Comment pep:known_by_projection supercontig:Nleu1.0:GL397431.1:2808310:2822401:1 gene:ENSNLEG00000007911 transcript:ENSNLET00000010105 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEGAGPRGAGPARRRGAGGPPSPLLPSLLLLLLWVLPDPVAPQELNPRGRNVCRAPGSQV
PTCCAGWRQQGDECGIAVCEGNSTCSENEVCVRPGECRCRHGYFGANCDTKCPRQFWGPD
CKELCSCHPHGQCEDVTGQCTCHARRWGARCEHACQCQHGTCHPRSGACRCEPGWWGAQC
ASACYCSATSRCDPQTGACLCHAGWWGRSCNNQCACNSSPCEQQSGRCQCRERTFGARCD
RYCQCFRGRCHPVDGTCACEPGYRGKYCREPCPAGFYGLGCRRRCGQCKGQQPCTVAEGR
CLTCEPGWNGTKCDQPCATGFYGEGCSHRCPPCRDGHACNHVTGKCTRCNAGWIGDRCET
KCSNGTYGEDCAFVCADCGSGHCDFQSGRCLCSPGVHGPHCNVTCPPGLHGSDCAQACSC
HEDSCDPVTGACHLETNQRKGVMGAGALLVLLVCLLLSLLGCCCACRGKDPVRRPRPRRE
LSLGRKKAPHRLCGRFSRISMKLPRIPLRRQKLPKVVGKDDSAGYLGETPLDAGSCWEMG
SPSLSSWKVGRLAPTHQQDGGGPVYCVPHEEAPAESRDPEVPTVPAEAPAPSPVPLTTPA
SAEEAMPLPASSDSERSASSVEGPGGALYARVARREARPARVRGEVGGLSLSPSPERRKP
PPPDPATKPKVSWIHGKHSAAAAGRAPSPPPPGPEAAPSPSKRKRTPSDKSAQPVEHGSP
RTRDPTPRPPGLPEEATALAAPSPPRARARGPRPLGAHGRRRSPAAPEAASMLAAELRGK
TRSLGRADGALVAQGPREKPAPPQKAKRAVPPTSPVRAPPATETPGPEKAGTDLPAPETP
RKKTPIQKPPRKKSREAAGELGRAGAPTL
Download sequence
Identical sequences ENSNLEP00000009644 ENSNLEP00000009644

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]