SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000009666 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000009666
Domain Number 1 Region: 1555-1667
Classification Level Classification E-value
Superfamily C-type lectin-like 7.53e-47
Family Noncollagenous (NC1) domain of collagen IV 0.000000503
Further Details:      
 
Domain Number 2 Region: 1443-1552
Classification Level Classification E-value
Superfamily C-type lectin-like 7.53e-45
Family Noncollagenous (NC1) domain of collagen IV 0.000000531
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000009666   Gene: ENSNLEG00000007914   Transcript: ENSNLET00000010128
Sequence length 1668
Comment pep:known_by_projection supercontig:Nleu1.0:GL397328.1:11080994:11238636:-1 gene:ENSNLEG00000007914 transcript:ENSNLET00000010128 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGPRLSVWLLLLPAALLLHEEHSRAAAKGGCAGSGCGKCDCHGVKGQKGERGLPGLQGVI
GFPGMQGPEGPQGPPGQKGDTGEPGLPGTKGTRGPPGASGYPGNPGLPGIPGQDGPPGPP
GIPGCNGTKGERGPLGPPGLPGFAGNPGPPGLPGMKGDPGEILGHVPGMLLKGERGFPGI
PGNPGPPGLPGLQGPIGPPGFTGPPGPPGPPGPPGEKGQMGLSFQGPKGDKGDQGVSGPP
GVPGQAQVQEKGDFATKGEKGQKGEPGFQGMPGVGEKGEPGKLGPRGKPGKDGDKGEKGS
PGFPGEPGYPGLVGRQGPQGEKGEAGPPGPPGIEIGTGPGEKKERGEPGTPGPRGEPGPK
GFPGLPGQPGAPGLPVPGLAGAPGFPGERGEKGDRGFPGVPLPGPSGRDGLPGPPGSPGP
PGQPGYTNGIVECQPGPPGDQGPPGIPGQPGFIGEIGEKGQKGESCLLCDIDGYRGPPGP
QGPPGEIGFPGQPGAKGDRGLPGRDGVAGVPGPQGTPGLIGQPGAKGEPGEIYFDLRLKG
DKGDPGFPGQPGMPGRAGSPGRDGHPGLPGPKGSPGSVGLKGERGPPGGVGFPGSRGDTG
PPGPPGYGPTGPIGDKGQAGFPGGPGSPGLPGPKGEPGKVVPLPGPPGAEGLPGSPGFPG
PQGDRGFPGTPGRPGLPGEKGAVGQPGIGFPGPPGPKGVDGLPGDMGPPGTPGRPGFNGL
PGNPGVQGQKGEPGVGLPGLKGLPGLPGIPGTPGEKGSIGVPGVPGEHGVIGPPGLQGIR
GEPGPPGLPGSVGSPGVPGIGPPGARGPPGGQGPPGLSGPPGIKGEKGFPGFPGLDMPGP
KGDKGAQGLPGITGQSGLPGLPGQQGAPGIPGFPGSKGEMGVMGTPGQPGSPGPVGAPGL
PGEKGDHGFPGSSGPRGDPGLKGDKGDVGLPGKPGSMDKVDMGSMKGQKGDQGEKGQIGP
IGEKGSRGDPGTPGVPGKDGQAGQPGQPGPKGDPGISGTPGAPGLPGPKGSVGGMGLPGT
PGEKGVPGIPGPQGSPGLPGDKGAKGEKGQAGPPGIGIPGLPGEKGDQGIVGFPGSPGEK
GEKGSIGIPGMPGSPGLKGSPGSVGYPGSPGLPGEKGDKGLPGLDGIPGVKGEAGLPGTP
GPTGPAGQKGEPGSDGIPGSAGEKGEPGLPGRGFPGFPGAKGDKGSKGEVGFPGLAGSPG
IPGSKGEQGFMGPPGPQGQPGLPGSPGHATEGPKGDRGPQGQPGLPGLPGPMGPPGLPGI
DGVKGDKGNPGWPGAPGVPGPKGDPGFQGMPGIGGSPGITGSKGDMGPPGVPGFQGPKGL
PGLQGIKGDQGDQGVPGAKGLPGPPGPPGPYDIIKGEPGLPGPEGPPGLKGLQGLPGPKG
QQGVTGLVGIPGPPGIPGFDGAPGQKGEMGPAGPTGPRGFPGPPGPDGLPGSMGPPGTPS
VDHGFLVTRHSQTIDDPQCPSGTKILYHGYSLLYVQGNERAHGQDLGTAGSCLRKFSTMP
FLFCNINNVCNFASRNDYSYWLSTPEPMPMSMAPITGDNIRPFISRCAVCEAPAMVMAVH
SQTIQIPPCPSGWSSLWIGYSFVMHTSAGAEGSGQALASPGSCLEEFRSAPFIECHGRGT
CNYYANAYSFWLATVERSEMFKKPTPSTLKAGELRTHVSRCQVCMRRT
Download sequence
Identical sequences ENSNLEP00000009666 ENSNLEP00000009666

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]