SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000009677 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000009677
Domain Number 1 Region: 56-100
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000000148
Family EGF-type module 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000009677   Gene: ENSNLEG00000007936   Transcript: ENSNLET00000010139
Sequence length 154
Comment pep:known_by_projection supercontig:Nleu1.0:GL397302.1:5974217:5981351:1 gene:ENSNLEG00000007936 transcript:ENSNLET00000010139 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALGVAISVYILFNAMTALTEEAAVTVTPPSTAQQGNWTVDKTEADNIEGPIALKFSHLC
LEDHNSYCINGACAFHHELEKAICRCFTGYTGERCEHLTLTSYAVDSYEKYIAIGIGVGL
LLSGFLVIFYCYIRKRCLKLKSPYNVCSGERRPL
Download sequence
Identical sequences A0A2I3HWG5
ENSNLEP00000009677 ENSNLEP00000009677 XP_003265793.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]