SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000009689 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000009689
Domain Number 1 Region: 141-186
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000001
Family EGF-type module 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000009689   Gene: ENSNLEG00000007940   Transcript: ENSNLET00000010153
Sequence length 252
Comment pep:known_by_projection supercontig:Nleu1.0:GL397302.1:6114729:6128782:1 gene:ENSNLEG00000007940 transcript:ENSNLET00000010153 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRAPLLPPAPVVLSLLILGSGHYAAGLDLNDTYSGKRGPFSGDHSADGFEVTSRSEMSSG
SEISPVSEMPSGSELPSGADYDYSEEYDNEPQIPGYIVDDSVRVEQVVKPPKNKTESENT
SDKPKRKKKGGKNGKNRRNRKKKNPCNAEFQNFCIHGECKYIEHLEAVTCKCQQEYFGER
CGEKSMKTHSMIDSSLSKIALAAIAAFMSAVILTAIAVITVQLRRRYVRKYEGEAEERKK
LRQENGNVHAIA
Download sequence
Identical sequences G1R902
XP_003265795.1.23891 ENSNLEP00000009689 ENSNLEP00000009689

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]