SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000009715 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000009715
Domain Number 1 Region: 83-138
Classification Level Classification E-value
Superfamily Zinc hairpin stack 1.31e-20
Family Zinc hairpin stack 0.0000271
Further Details:      
 
Domain Number 2 Region: 16-82
Classification Level Classification E-value
Superfamily CHY zinc finger-like 1.57e-19
Family CHY zinc finger 0.0000105
Further Details:      
 
Domain Number 3 Region: 143-190
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000353
Family RING finger domain, C3HC4 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000009715   Gene: ENSNLEG00000007956   Transcript: ENSNLET00000010183
Sequence length 261
Comment pep:known_by_projection supercontig:Nleu1.0:GL397302.1:7157250:7190562:-1 gene:ENSNLEG00000007956 transcript:ENSNLET00000010183 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAATAREDGASGQERGQRGCEHYDRGCLLKAPCCDKLYTCRLCHDNNEDHQLDRFKVKEV
QCINCEKIQHAQQTCEECSTLFGEYYCDICHLFDKDKKQYHCENCGICRIGPKEDFFHCL
KCNLCLAMNLQGRHKCIENVSRQNCPICLEDIHTSRVVAHVLPCGHLLHRTCYEEMLKEG
YRCPLCMHSALDMTRYWRQLDDEVAQTPMPSEYQNMTVDILCNDCNGRSTVQFHILGMKC
KICESYNTAQAGGRRISLDQQ
Download sequence
Identical sequences A0A0D9QXF5 A0A2I3GFY2 A0A2I3NHQ1 A0A2K5E438 A0A2K5HCL6 A0A2K5NYZ2 A0A2K6A2D4 A0A2K6DGE4 F7HPB9 G3SAC1 G7P5J8 H2PDM0 Q96PM5
ENSNLEP00000009715 9544.ENSMMUP00000012031 9600.ENSPPYP00000016571 9606.ENSP00000321239 gi|58331195|ref|NP_056251.2| ENSMMUP00000012031 ENSP00000321239 NP_001248474.1.72884 NP_056251.2.87134 NP_056251.2.92137 XP_002814923.1.23681 XP_003265800.1.23891 XP_004038884.1.27298 XP_005555101.1.63531 XP_007997098.1.81039 XP_011732023.1.29376 XP_011782575.1.43180 XP_011821557.1.47321 XP_011895814.1.92194 XP_012302407.1.9421 ENSP00000321239 HR2942 HT2 ENSMMUP00000012030 ENSPPYP00000016571 ENSPPYP00000016571 ENSNLEP00000009715 ENSP00000321239

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]