SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000009737 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000009737
Domain Number 1 Region: 451-759
Classification Level Classification E-value
Superfamily Folate-binding domain 1.22e-81
Family Aminomethyltransferase folate-binding domain 0.0000636
Further Details:      
 
Domain Number 2 Region: 42-257,390-441
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.94e-45
Family FAD-linked reductases, N-terminal domain 0.00022
Further Details:      
 
Domain Number 3 Region: 761-854
Classification Level Classification E-value
Superfamily Aminomethyltransferase beta-barrel domain 0.00000000000213
Family Aminomethyltransferase beta-barrel domain 0.006
Further Details:      
 
Domain Number 4 Region: 259-335
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 0.00000000000589
Family L-aminoacid/polyamine oxidase 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000009737   Gene: ENSNLEG00000007974   Transcript: ENSNLET00000010208
Sequence length 875
Comment pep:known_by_projection supercontig:Nleu1.0:GL397305.1:9367:49663:-1 gene:ENSNLEG00000007974 transcript:ENSNLET00000010208 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFYRLLSIVGRQRASPGWQNWSSARNSASAAEARSMALPTQAQVVICGGGIMGTSVAYHL
SKMGWKDIVLLEQGRLAAGSTRFCAGILSTARHLTIEQKMADYSSKLYHQLEQETGIQTG
YTRTGSIFLAQTQDRLISLKRINAGLNVIGIPSEIISPKKVAELHHLLNVHDLVGAMHVP
EDAVVSSADVALALASAASQNGVQIYDRTSVLHVMVKKGQVTGVETDKGQIECQYFVNCA
GQWAYELGLSNEEPVSIPLHACEHFYLLTRPLETPLQSSTPTIVDADGRIYIRNWQGGIL
SGGFEKNPKPIFTEGKNQLEIQNLQEDWDHFVPCLISLLRAVHRPMFVSSEKLRKVPKTI
QLVYGNLGSFDSLSSRFVEYLLSSQISHLSPNKYLAEWMVHGYPSENVWELDLKRFGALQ
SSRTFLRHRVMEVMPLMYDLKVPRWDFQTGRQLRTSPLYDRLDAQGARWMEKHGFERPKY
FVPPGKDLLALEQSKTFYKPDWFDIVESEVKCCKEAVCVIDMSSFTKFEITSTGDQALEV
LQYLFSNDLDVPVGHIVHTGMLNEGGGYENDCSIARLNKRSFFMISPTDQQVHCWAWLKK
HMPKDSNLLLEDVTWKYTALNLIGPRAVDVLSELSYAPMTPDHFPSLFCKEMSVGYANGI
RVMSMTHTGEPGFMLYIPIEYALHVYNEVMSVGQKYGIRNAGYYALRSLRIEKFFAFWGQ
DINNLTTPLECGRESRVKLEKGMDFIGRDALLQQKQNGVYKRLTMFILDDHDTDLDLWPW
WGEPIYRNGQYVGKTTSSAYSYSLERHVCLGFVHNFSEDTGEEQVVTADFINQGEYEIDI
AGYRFQAKAKLYPIASLFTQKRRKDDMELSDLHGK
Download sequence
Identical sequences ENSNLEP00000009737

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]