SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000009752 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000009752
Domain Number 1 Region: 1-142
Classification Level Classification E-value
Superfamily Globin-like 4.11e-49
Family Globins 0.000000213
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000009752   Gene: ENSNLEG00000007986   Transcript: ENSNLET00000010223
Sequence length 142
Comment pep:novel supercontig:Nleu1.0:GL397322.1:129108:129975:1 gene:ENSNLEG00000007986 transcript:ENSNLET00000010223 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVLSPADKNNVKAAWGKVGAHAGDYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHG
KKVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHHPAEFTP
AVHASLDKFLASVSTVLTSKYR
Download sequence
Identical sequences G1R963
ENSNLEP00000009752 XP_003269148.1.23891 XP_012352645.1.23891 XP_012352646.1.23891 ENSNLEP00000009752

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]