SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000009779 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000009779
Domain Number 1 Region: 334-430
Classification Level Classification E-value
Superfamily Immunoglobulin 1.67e-20
Family I set domains 0.012
Further Details:      
 
Domain Number 2 Region: 451-780
Classification Level Classification E-value
Superfamily 3-carboxy-cis,cis-mucoante lactonizing enzyme 7.06e-17
Family 3-carboxy-cis,cis-mucoante lactonizing enzyme 0.042
Further Details:      
 
Domain Number 3 Region: 65-133
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000000043
Family Ovomucoid domain III-like 0.0094
Further Details:      
 
Domain Number 4 Region: 257-347
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000301
Family I set domains 0.037
Further Details:      
 
Domain Number 5 Region: 180-251
Classification Level Classification E-value
Superfamily EF-hand 0.000000663
Family Calmodulin-like 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000009779   Gene: ENSNLEG00000008014   Transcript: ENSNLET00000010250
Sequence length 842
Comment pep:known_by_projection supercontig:Nleu1.0:GL397305.1:558704:977294:-1 gene:ENSNLEG00000008014 transcript:ENSNLET00000010250 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKPGGFWLHLTLLGASLPAVLGWTDPGTSRGPDVGVGESQAEEPRSFEVTRREGLSSHNE
LLASCGKKFCSRGSRCVLSRKTGEPECQCLEACRPSYVPVCGSDGRFYENHCKLHRAACL
LGKRITVIHSKDCFLKGDKCTMAGYARLKNVLLALQTRLQPLQEGDSRQDPASQKHLLVE
SLFRDLDADGNGHLSSSELAQHVLKKQDLDEDLLGCSPGDLLRFDDYNSDSSLTLREFYM
AFQVVQLSLAPEDRVSVTTVTVGLSTVLTCAVRGDLRPPIIWKRNGLTLNFLELEDINDF
GEDDSLYITKVTTVHMGNYTCHASGHEQLFQTHVLQVNVPPVIRVYPESQAQEPGVAASL
RCHAEGIPMPRITWLKNGVDVSTQMSKQLSLLANGSELHISSVRYEDTGAYTCIAKNEVG
VDEDISSLFIEDSARKTLANILWREEGLSVGNMFYVFSDDGIIVIHPVDCEIQRHLKPTE
KIFMSYEEICPQREKNATQPCQWVSAVNVRNRYIYVAQPALSRVLVVDIQAQKVLQSIGV
DPLPAKLSYDKSHDQVWVLSWGDVHKSQPSLQVITEASAGQGQHLIRTPFAGVDDFFIPP
TNLIINHIRFGFIFNKSDPAVHKVDLETMMPLKTIGLHHHGCVPQAMAHTHLGGYFFIQC
QQDSPISAARQLLVDSVTDSVLGPNGDVTGTPHTSPDGRFIVSAAADSPWLHVQEITLQG
EIQTLYDLQINSGISDLAFQRSFTESNQYNIYAALHTEPDLLFLELSTGKVGMLKNLKEP
PTGPSQPWGDARRIMRDSGLFGQYLLTPAQESLFLINGRQNTLRCEVSGIKGGTTVVWVG
EV
Download sequence
Identical sequences G1R990
ENSNLEP00000009779 ENSNLEP00000009779

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]