SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000009786 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000009786
Domain Number 1 Region: 110-206
Classification Level Classification E-value
Superfamily Immunoglobulin 3.19e-29
Family C1 set domains (antibody constant domain-like) 0.0000158
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000009786   Gene: ENSNLEG00000008022   Transcript: ENSNLET00000010257
Sequence length 213
Comment pep:known_by_projection supercontig:Nleu1.0:GL397618.1:10344:20731:1 gene:ENSNLEG00000008022 transcript:ENSNLET00000010257 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRPGTGQGGLEGPGEPGPNLRQRWPLLLLGLAMVTHGLLRPTAAPQSRALGPGAPGGSSR
SSLRSRWGRFLLQRGSWTGPRCWPRGFQSKHNSVTHVFGSGTQLTVLTQPKAAPSVTLFP
PSSEELQANKATLVCLMNDFYPGSLRVTWKADGTPITQGVEMTTPSKQSNSKYAASSYLS
LTPEQWRSRRSYSCQVTHEGSTVEKTVAPAECS
Download sequence
Identical sequences ENSNLEP00000009786 XP_003282108.1.23891 ENSNLEP00000009786

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]