SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000009907 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000009907
Domain Number 1 Region: 28-164
Classification Level Classification E-value
Superfamily C-type lectin-like 4.02e-42
Family C-type lectin domain 0.000000307
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000009907   Gene: ENSNLEG00000008128   Transcript: ENSNLET00000010390
Sequence length 166
Comment pep:known_by_projection contig::ADFV01134573.1:57907:60875:-1 gene:ENSNLEG00000008128 transcript:ENSNLET00000010390 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQTNSFFMLIFSLMFLSPSQGQESQTELPNPRISCPEGTNAYRSYCYYFNEDPETWVDA
DLYCQNMNSGNLVSVLTQAEGAFVASLIKESGTDDSNVWIGLHDPKKNRRWHWSSGSLVS
YKSWDIGAPSTANAGYCASLTSCSGFKKWKDESCEKKFSFVCKFKN
Download sequence
Identical sequences H9HA09
ENSNLEP00000009907 XP_003282184.1.23891 XP_012359359.1.23891 ENSNLEP00000009907

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]