SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000009946 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000009946
Domain Number 1 Region: 5-50
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000000894
Family EGF-type module 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000009946   Gene: ENSNLEG00000008162   Transcript: ENSNLET00000010431
Sequence length 113
Comment pep:known_by_projection supercontig:Nleu1.0:GL397378.1:220278:320077:-1 gene:ENSNLEG00000008162 transcript:ENSNLET00000010431 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPTDHEEPCGPSHKSFCLNGGLCYVIPTIPSPFCRCIENYTGARCEEVFLPSSSIQTKSN
LFEAFVALAVLVTLIIGAFYFLCRKGHFQRASSVQYDINLVETSSTSAHHRNG
Download sequence
Identical sequences ENSNLEP00000009946

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]