SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000009960 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000009960
Domain Number 1 Region: 460-568
Classification Level Classification E-value
Superfamily SEA domain 0.0000000000549
Family SEA domain 0.013
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000009960
Domain Number - Region: 412-440
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0011
Family EGF-type module 0.028
Further Details:      
 
Domain Number - Region: 383-411
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00164
Family EGF-type module 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000009960   Gene: ENSNLEG00000008166   Transcript: ENSNLET00000010445
Sequence length 693
Comment pep:known_by_projection supercontig:Nleu1.0:GL397399.1:1196:18945:1 gene:ENSNLEG00000008166 transcript:ENSNLET00000010445 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPETPTQTPPVLTSATGTQTSPVPTTVTFGSMDSSTSTLHTLTPSTALSKIMSTSQYPVP
STHSSTLQTTPSITSLQTSLTSTSEFTTESFTRGSTSTNAILTSFSTIIWSSTPTIIMSS
SPSSASITPVFSTTTHSVPSSPYIFSTENVGSSSITAFPTLSSSATTSTSPTSSSLTTAL
TKITPFSYISLPSTTPCPETITITIVPASPTDPCVEMDPSTEAPSPPTTPLTVFPFTTEM
VTCPSSISIQTTLTTYMDTSSMTPESEPSITPNASSSTGTGTVPTNTVFTSTQMPTSETW
LSTSSVIPPPLPGVSTVPLTTKPSSSLPTILRTSSKSTHPSPPTTRTSETPVATTQTPTT
LTSRRTTPITSQMTTQSPLTTTAGTCDNGGTWEQGQCACLPGFSGDRCQLQTRCQNGGQW
DGLKCQCPSTFYGSRCEFAVEQVDLDVVETEVGMEVSVDQQFSPDLNDNTSQAYRDFNKT
FWNQMQKIFADMRGFTFKGVEILSLRNGSIVVDYLVLLELPFSRQLESEYEQVKTALKEA
LQNASQDANSCQDSQTLCFKPDSIKVNNNSKTELTPEAICRRAAPTGYEEFYFPLVEATR
LRCVTKCTSGVDNAIDCHQGQCVLERSGPACRSWDQDRKWFETWDEEVVGTFSNWSFEDE
GTDKHKNFHVALENVDTTVKVHIKRPEMTSSSV
Download sequence
Identical sequences ENSNLEP00000009960

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]