SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000009975 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000009975
Domain Number 1 Region: 25-127
Classification Level Classification E-value
Superfamily TPR-like 1.61e-30
Family Tetratricopeptide repeat (TPR) 0.00000204
Further Details:      
 
Domain Number 2 Region: 220-299
Classification Level Classification E-value
Superfamily RING/U-box 1.85e-24
Family U-box 0.0000144
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000009975   Gene: ENSNLEG00000008170   Transcript: ENSNLET00000010460
Sequence length 303
Comment pep:known_by_projection supercontig:Nleu1.0:GL397322.1:672549:675200:1 gene:ENSNLEG00000008170 transcript:ENSNLET00000010460 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKGKEEKEGGARLGAGGGSPEKSPSAQELKEQGNRLFVGRKYPEAAACYGRAITRNPLVA
VYYTNRALCYLKMQQHEQALADCRRALELDGQSVKAHFFLGQCQLEMESYDEAIANLQRA
YSLAKEQRLNFGDDIPSALRIAKKKRWNSIEERRIHQESELHSYLSRLIAAERERELEEC
QRNHEGDEDDSHVRAQQACIEAKHDKYMADMDELFSQVDEKRKKRDIPDYLCGKISFELM
REPCITPSGITYDRKDIEEHLQRVGHFDPVTRSPLTQEQLIPNLAMKEVIDAFISENGWV
EDY
Download sequence
Identical sequences A0A0D9RIQ2 A0A2I2YCX7 A0A2K5LKA4 A0A2K5VYR9 A0A2K6C3B7 A0A2K6KIH1 A0A2K6QHE2 H2NPL2 H2QA80 H9FNL3 Q9UNE7
ENSPTRP00000012898 400196 ENSP00000219548 NP_001244487.1.72884 NP_005852.2.87134 NP_005852.2.92137 XP_002825973.1.23681 XP_003269167.1.23891 XP_003808862.1.60992 XP_004056940.1.27298 XP_005590860.1.63531 XP_007978781.1.81039 XP_009428300.1.37143 XP_010380115.1.97406 XP_011746789.1.29376 XP_011890497.1.92194 XP_017713920.1.44346 gi|56181387|ref|NP_005852.2| ENSNLEP00000009975 ENSP00000219548 ENSP00000219548 ENSGGOP00000020990 ENSPTRP00000012898 ENSPPYP00000007837 ENSPPYP00000007837 ENSGGOP00000020990 9598.ENSPTRP00000012898 9600.ENSPPYP00000007837 9606.ENSP00000219548 ENSNLEP00000009975

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]