SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000009985 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000009985
Domain Number 1 Region: 506-775
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.87e-65
Family Protein kinases, catalytic subunit 0.00000305
Further Details:      
 
Domain Number 2 Region: 213-401
Classification Level Classification E-value
Superfamily Fibronectin type III 8.07e-26
Family Fibronectin type III 0.0029
Further Details:      
 
Domain Number 3 Region: 45-129
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000014
Family V set domains (antibody variable domain-like) 0.00018
Further Details:      
 
Domain Number 4 Region: 129-194
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000445
Family I set domains 0.0000677
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000009985   Gene: ENSNLEG00000008203   Transcript: ENSNLET00000010473
Sequence length 869
Comment pep:novel supercontig:Nleu1.0:GL397378.1:531734:534423:-1 gene:ENSNLEG00000008203 transcript:ENSNLET00000010473 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GQLGLLLLPPPPPQRLRLLLAALASLLLPESAAAGLKLMGAPEKLTVSGQLVKLNCSVEG
MEEPDIQWVKDGAVVQNLEQLCIPVSEQHISFLSLKSVVCSDRGQYWCQVDGGKTEISQP
VWLTVEGVPLFTVEPKDLAVPPNAPFQLSCKAVGPPEPVTIVWWRGTTKIRGPAPSPSVL
NVTGPRAPMFSCEAHSLKCLASSRIATVLLQAFPAVPFNITVTKLSSGNTSVAWMPGADG
RALLQSCTVQVTQAPGGWEVLAVVVLVPPFTCLLRDLVPATSYSLRVCCANSLGPSPYAD
WVPFQTKGLAPASVPQNLHAIHTDSGLILEWEEVIPEGPLEGPLGPYKLSWVQDNGTQDE
LTMEGTRANLTGWDPQKGLIVHVCVSNAVGCGPWSQPLVVSSHDHAGQKGPPHSRTSWVP
VVLGVLTALVMVAALALILLLKRRKEMWFGQGFDSVMAWGEPAIHFRAARSFNRERPKCI
ETLDSLGINSELKEKLEDVLIPEQQFTGQMLGKGEFGSVWAQLKQEDGSFVKVAVKMLKA
DIIASSDIEEFLREAACMKEFDHPHVAKLVGVSLASRAKGCHPIPMVILLFMKHGDLHAF
LLTSQLGENPFLIRFMVDIACGMEYLSSRNFIHRDLAAQNCMLAEDMTVCVADFGLSWKI
YSGDYYCQGCASKLPVKWLALESLADNLYTVHSDVWAFGVTMWEIMTRGQMPYAGIKNAE
IYNYLIGGNRLKQLPERMEDVYDRMYQCWSADPKQRPSFACLQMELENILGQLSVLSASQ
DPLYINIKRAEEPTVGGSLELPSRYQPYSGAGDGSGMGAVGGTPSDYYILTPGGLAEQPG
QAEHQPESPLNETQRLLLLQQGLLPHNSC
Download sequence
Identical sequences ENSNLEP00000009985 ENSNLEP00000009985

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]