SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000010039 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000010039
Domain Number 1 Region: 160-308
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 4.32e-30
Family Toll/Interleukin receptor TIR domain 0.0015
Further Details:      
 
Domain Number 2 Region: 8-106
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000189
Family I set domains 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000010039   Gene: ENSNLEG00000008229   Transcript: ENSNLET00000010533
Sequence length 410
Comment pep:known_by_projection supercontig:Nleu1.0:GL397536.1:142327:150524:-1 gene:ENSNLEG00000008229 transcript:ENSNLET00000010533 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGVCDRAPDFLSPSEDQVLRPALGSSVALNCTAWVVSGPHCSLPSVQWLKDGLPLGNGG
HYSLHEYSWVKANLSEVFVSSVLGVNVTSAEVYGDFTCSTQNVSSSSFTLQRAGPTSHVA
AVLASLLVLLALLLAALLYVKCRLNVLLWYQDAYGEVEMNDGKLYDAYVSYSDCPEDRKF
VNFILKPQLERRRGYKLFLDDRDLLPRAEPSADLLVNLSRCRRLIVVLSDAFLSRAWCSH
SFREGLCRLLELTRRPIFITFEGQGSDPAHPALRLLRQHRHLVTLLLWRPGSVTPSSDFW
KELQLALPRKVQYRPVEGDPQTQLQDDKDPMLILRGRVPEGRALDSEVDPDPEGDLGVRG
PVFGEPSAPPHTSGVSLGESRSSEVDVSDLGSRNYSARTDFYCLVSKDDM
Download sequence
Identical sequences G1R9Z2
ENSNLEP00000010039 XP_003281346.1.23891 XP_003281347.1.23891 XP_003281348.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]