SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000010049 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000010049
Domain Number 1 Region: 553-839
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.16e-82
Family Protein kinases, catalytic subunit 0.00000000366
Further Details:      
 
Domain Number 2 Region: 1-128
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 4.68e-54
Family Ephrin receptor ligand binding domain 0.0000103
Further Details:      
 
Domain Number 3 Region: 253-460
Classification Level Classification E-value
Superfamily Fibronectin type III 1.39e-40
Family Fibronectin type III 0.00000376
Further Details:      
 
Domain Number 4 Region: 859-926
Classification Level Classification E-value
Superfamily SAM/Pointed domain 1.17e-19
Family SAM (sterile alpha motif) domain 0.0000331
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000010049
Domain Number - Region: 184-250,285-310
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000115
Family Growth factor receptor domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000010049   Gene: ENSNLEG00000008246   Transcript: ENSNLET00000010544
Sequence length 930
Comment pep:known_by_projection supercontig:Nleu1.0:GL397339.1:3526610:3681593:1 gene:ENSNLEG00000008246 transcript:ENSNLET00000010544 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSPNQNNWLRTSWIPRDGARRVYAEIKFTLRDCNSMPGVLGTCKETFNLYYLESDRDLGA
STQESQFLKIDTIAADESFTGADLGVRRLKLNTEVRGVGPLSKRGFYLAFQDIGACLAIL
SLRIYYKKCPAMVRNLAAFSEAVTGADSSSLVEVRGQCVRHSEERDTPKMYCSAEGEWLV
PIGKCVCSAGYEERRDACVACELGFYKSAPGDQLCARCPPHSHSAAPAAQACHCDLSYYR
AALDPPSSACTRPPSAPVNLISSVNGTSVTLEWAPPLDPGGRSDVTYNAVCRRCPWALSR
CEACGSGTRFVPQQTSLVQASLLVANLLAHMNYSFWIEAVNGVSDLSPEPRRAAVVNITT
NQAAPSQVVVIRQERAGQTSVSLLWQEPEQPNGIILEYEIKYYEKDKEMQSYSTLKAVTT
RATVSGLKPGTRYVFQVRARTSAGCGRFSQAMEVETGKPRPRYDTRTIVWICLTLITGLV
VLLLLLICKKRHCGYSKAFQDSDEEKMHYQNGQAPPPVFLPLHHPPGKLPEPQFYAEPHT
YEEPGRAGRSFTREIEASRIHIEKIIGSGESGEVCYGRLRVPGQRDVPVAIKALKAGYTE
RQRRDFLSEASIMGQFDHPNIIRLEGVVTRGRLAMIVTEYMENGSLDAFLRTHDGQFTIM
QLLGMLRGVGAGMRYLSHLGYVHRDLAARNVLVDSNLVCKVSDFGLSRVLEDDPDAAYTT
TGGKIPIRWTAPEAIAFRTFSSASDVWSFGVVMWEVLAYGERPYWNMTNRDVISSVEEGY
RLPAPMGCPRALHQLMLDCWHKDRAQRPRFSQIVSVLDALIRSPESLRATATVSRCPPPA
FARSCFDLRGGSGGGGGLTVGDWLDSIRMGRYRDHFAAGGYSSLGMVLRMNAQDVRALGI
TLMGHQKKILGSIQTMRAQLTSTQGPRRHL
Download sequence
Identical sequences ENSNLEP00000010049

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]