SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000010058 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000010058
Domain Number 1 Region: 858-940
Classification Level Classification E-value
Superfamily SH3-domain 4.33e-21
Family SH3-domain 0.00032
Further Details:      
 
Domain Number 2 Region: 127-204
Classification Level Classification E-value
Superfamily SH3-domain 7.88e-20
Family SH3-domain 0.00000596
Further Details:      
 
Domain Number 3 Region: 755-834
Classification Level Classification E-value
Superfamily SH3-domain 9.84e-16
Family SH3-domain 0.001
Further Details:      
 
Domain Number 4 Region: 266-424
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000226
Family Fibronectin type III 0.0056
Further Details:      
 
Domain Number 5 Region: 446-502
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000389
Family Fibronectin type III 0.0000327
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000010058   Gene: ENSNLEG00000008265   Transcript: ENSNLET00000010556
Sequence length 964
Comment pep:known_by_projection supercontig:Nleu1.0:GL397389.1:2746862:2807208:-1 gene:ENSNLEG00000008265 transcript:ENSNLET00000010556 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQSKVRELEEKCRTQSEQFNLLSRDLEKFRQHAGKIDLLGGSAVAPLDVSTAPGKPFPQF
VNGLATSLGKGQESAIGGGSAIGEYIRPLPQPGDRREPLSTKPTFLSRSGSPRCRSESDM
ENERNSNTSKQRYSGKVHLCVARYSYNPFDGPNENPEAELPLTAGKYLYVYGDMDEDGFY
EGELLDGQRGLVPSNFVDFVQDESRLASTLGNERDQNFINHSGIGLEGEHILDLHSPTHV
DAGVTDNSAGTLDVNIDDIGEDIVPYPRKITLIKQLAKSVIVGWEPPAVPPGWGTVSSYN
VLVDKETRMNLTLGSRTKALIEKLNMAACTYRISVQCVTSRGSSDELQCTLLVGKDVVVA
PSHLRVDNITQISAQLSWLPTNSNYSHVIFLNEEEFDIVKAARYKYQFFNLRPNMAYKVK
VLAKPHQMPWQLPLEQREKKEAFVEFSTLPAGPPAPPQDVTVQAGVTPATIRVSWRPPVL
TPTGLSNGANVTGYGVYAKGQRVSFRWVGGPLLGSNAAGTGPVFAQWRRQDCLKKKKKKK
KILVGLGQREGGRARPRAVWGGAWPGSEGLKVWRVQVGLSVAEGGPASPLCLLSLSKLEK
RSVFLERSSAGQYAASDEEDAYDSPDFKRRGASVDDFLKGSEFGKQPHCCHGDEYHTESS
RGSDLSDIMEEDEEELYSEMQLEDGGRRRPSGTSHNALKILGNPASAGRVDHMGRRFPRG
SAGPQRSRPVTVPSIDDYGRDRLSPDFYEESETDPGAEELPARIFVALFDYDPLTMSPNP
DAAEEELPFKEGQIIKVYGDKDADGFYRGETCARLGLIPCNMVSEIQADDEEMMDQLLRQ
GFLPLNTPVEKIERSRRSGRHHSVSTRRMVALYDYDPRESSPNVDVEAELTFCTGDIITV
FGEIDEDGFYYGELNGQKGLVPSNFLEEVPDDVEVYLSDAPSHYSQDTPVRSKAKRKKSV
HFTP
Download sequence
Identical sequences ENSNLEP00000010058 ENSNLEP00000010058

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]