SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000010151 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000010151
Domain Number 1 Region: 604-765
Classification Level Classification E-value
Superfamily Growth factor receptor domain 3.93e-29
Family Growth factor receptor domain 0.00061
Further Details:      
 
Domain Number 2 Region: 508-664
Classification Level Classification E-value
Superfamily Growth factor receptor domain 8.17e-28
Family Growth factor receptor domain 0.00062
Further Details:      
 
Domain Number 3 Region: 902-1060
Classification Level Classification E-value
Superfamily Growth factor receptor domain 9.92e-27
Family Growth factor receptor domain 0.0007
Further Details:      
 
Domain Number 4 Region: 3037-3181
Classification Level Classification E-value
Superfamily CalX-like 4.84e-25
Family CalX-beta domain 0.0012
Further Details:      
 
Domain Number 5 Region: 2551-2671
Classification Level Classification E-value
Superfamily CalX-like 6.41e-25
Family CalX-beta domain 0.00084
Further Details:      
 
Domain Number 6 Region: 805-962
Classification Level Classification E-value
Superfamily Growth factor receptor domain 4.4e-24
Family Growth factor receptor domain 0.002
Further Details:      
 
Domain Number 7 Region: 2916-3041
Classification Level Classification E-value
Superfamily CalX-like 5.1e-24
Family CalX-beta domain 0.0022
Further Details:      
 
Domain Number 8 Region: 2797-2912
Classification Level Classification E-value
Superfamily CalX-like 7.59e-20
Family CalX-beta domain 0.0015
Further Details:      
 
Domain Number 9 Region: 421-523
Classification Level Classification E-value
Superfamily Growth factor receptor domain 2.09e-18
Family Growth factor receptor domain 0.001
Further Details:      
 
Domain Number 10 Region: 2672-2797
Classification Level Classification E-value
Superfamily CalX-like 1.57e-17
Family CalX-beta domain 0.0024
Further Details:      
 
Domain Number 11 Region: 81-154
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000335
Family VWC domain 0.0096
Further Details:      
 
Domain Number 12 Region: 157-216
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000262
Family VWC domain 0.032
Further Details:      
 
Domain Number 13 Region: 219-280
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000471
Family VWC domain 0.018
Further Details:      
 
Domain Number 14 Region: 272-344
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000628
Family VWC domain 0.012
Further Details:      
 
Domain Number 15 Region: 26-88
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000607
Family VWC domain 0.004
Further Details:      
 
Domain Number 16 Region: 367-421
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000753
Family VWC domain 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000010151   Gene: ENSNLEG00000008239   Transcript: ENSNLET00000010651
Sequence length 4011
Comment pep:known_by_projection supercontig:Nleu1.0:GL397302.1:9974631:10443583:1 gene:ENSNLEG00000008239 transcript:ENSNLET00000010651 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGVLKVWLGLALALAEFAVLPHHSEGACVYQGSLLADATIWKPDSCQNCRCHGDIVICKP
AVCRNPQCAFEKGEVLQIAANQCCPECVLRTPGSCHHEKQIHEHGTKWASSPCSVCSCNH
GEVRCTPQPCPPLSCGHQELAFIPEGSCCPVCVGPGKPCSYEGRVFQDGEDWRLSRCAKC
LCRNGVAQCFTAQCQPLFCNQDETVVRVPGKCCPQCSARSCFAAGQVYEHGEQWSENACT
TCICDRGEVRCHKQACLPLRCGKGQSRARRHGQCCEECVSSAGSCSYDGVVRYQDEMWKG
SACEFCMCDRGQVTCQTGECAKVECARGEELIHLDGKCCPECISRNGYCVYEENGEFMSS
NASEVKHIPEGEKWEDGPCKVCECRGAQVTCYEPSCPPCPVGTLALEVKGQCCPDCTSVH
CHPDCLTCSQSPDHCDLCQDPTKLLQNGRCVHSCGLGFYQAGSLCLACQPQCSTCTSGLE
CSSCQPPLLMQHGQCVSTCGDGFYQDRHSCAVCHESCAGCWGPTEKHCLACRDPLHVLRD
GGCENSCGKGFYNRQGTCSACDQSCESCGPSSPRCLTCTEKTVLHDGKCMSECPGRYYAD
ATGRCKVCHNSCASCSGPTASHCTACSPPKTLRQGHCLPHCGEGFYSDHGVCKACHSSCL
ACMGPAPSHCTGCKKPEEGLQVEQLSGAGIPSGECLAQCRAHFYLESTGICEACHQSCLR
CAGKSPHNCTDCGPSHVLLDGQCLSQCPDGYFHQEDSCTECHPTCRQCHGPLESDCISCY
PHVSLTNGNCRTSCREEQFLNLVGYCADCHPLCQHCAADLHNTGSICLRCQNARYLLLGD
HCVPDCPSGYYAERGACKKCHSSCRTCQGSGPFSCSSCDTNLVLSHTGTCSTTCFPGHYL
DDNHVCQPCNTHCGSCDSQASCTSCRDRNKVLLFGECQYESCAPQYYLDFSTNTCKECDW
SCSACSGPLKTDCLQCMDGYVLQDGACVEQCLSSFYQDSGLCKNCDSYCLQCQGPHECTR
CEGPFLLLEAQCVQECGKGYFADHAKHKCTACPRGCLHCSHRDRCHLCDHGFFLKSGLCI
YNCVPGLSAHTSNETCSGKIHTPSLRVNGSLILPIGSIKPLDFSLLNVRDQEGRVEDLLF
HVVSSPTNGQLVLSRNGKEVQLDKAGRFSWKDVNEKKVRFVHSKEKLRKGYFFLKISDQQ
FFSEPQLINIQAFSTQAPYVLKNEVLHISRGERATITTQLLDIRDDDNPQDVVVEVIDPP
LHGQLLQTLQSPAAPIYQFQLDELSRGLLHYAHDGSDSTSDVAVLQANDGHSFRNILFQV
KTVPQNDRGLQLVANSMVWVPEGGMLQITNRILQAEAPGASAEEITYKITQDYPQFGEVV
LLVNMPADSPADEGQHLPDGRTATPTSTFTQQDINEGIVWYRHSGAPAQSDSFRFEVSSA
SDAQTRLESRMFNIAILPQTPEAPKVSLEASLHMTAREDGLTVIQPHSLSFINSERPSGK
IVYNITLPLHPNQGIIEHRDHPHSPIRYFTQEDINQGKVMYRPPPAAPHLQELMAFSFAG
LPESVKFHFTVSDGEHTSPEMVLTIHLLPSDQQLPVFQVTAPRLAVSPGSSTSVGLQVVV
RDAETAPKELFFELRRPPRHGVLLKHTAEFRRPMATGDTFTYEDVEKNALQYIHDGSSTR
EDSMEISVTDGLTVTMLEVRVEVSLTEDRGPRLAAGSSLSITVASKSTAIITRSHLAYVD
DSSPDPEIWIQLNYLPIYGTLLRTSGSEVEELSEVSNFTMEDINNKKIRYSAVFETDGHL
VTDSFYFSVSDMDHNHLDNQMFTIMITPAENPPPVIAFADLITVDEGGRAPLSFHHFFAT
DDDDNLQGNAIIKLSALPKYGCIENTGTGDRFGPETTSDLEASFPIQDVLENYIYYFQSV
HESIEPTHDIFSFYVSDGTSRSEIHSINITIERKNDEPPRMTLQPLRVQLSSGVVISNSS
LSLQDLDTTDNELIFVLTKKPDHGHLLWRQTASEPLENGRVLAQGSTFTYQDILAGLVGY
VPSVPGVVVDEFQFSLTDGLHMDMGRMKIYIELPTSDTPHLAINQGLQLSAGSVARITEQ
HLKVTDIDSDDRQVMYIMKEDPGAGRLQMVKHGNLEQISTKGPIRSFTQADISQGHVEYS
HGTGEPGGSFAFKFDVVDGEGNRLIDQSFSISVLEDKSPPVIITNKGLVLDENSVKKITT
LQLSATDQDSGPTELIYRITRQPQLGHLEHATSPGIQISSFTQADLTSRNVQYVHSSEAE
KHSDAFSFTLSDGVNEVTQTFHITLHPVDDSLPIIHNLMRVQEGVRXXXXXXXXXXILPS
GQAESVTFTIVQPPRHGTIERTSNGQHFHLTSTFTMEDIYQNRVSYSHDGSNSLKDRFTF
TVSDGTNPFFIIEEGGKEIMTAAPQPFRVDVLPVDDGTPRIVTNLGLQWLEYMDGKATNL
ITKKELLTMDPDTEDAQLVYEIMTGPKHGFVENKLQPGRAAATFTQEDVNLGLIRYVLHK
EKIREMMDSFQFLVKDSKPNVVSDNVFHIQWSLISFKYTSYNVSEKAGSVSVTVQRTGNL
NQYAIVLCRTEQGTASSSSRVSSQPGQQDYVEYAGQVQFDEREDTKSCTIVINDDDVFEN
VESFTVELSMPAYALLGEFTQAKVIINDTEDEPTLEFDKKIYRVNESAGFLFAPIERKGD
ASSVVSAICYTVPKSAMGSSLYALESGSDFKSRGMSDVSRVIFGPGVTMSTCDVMLIDDS
EYEEEEEFEIALADASDNARIGRVATAKVLISGPNDASTVSLGNTAFMVSEDAGTVKIPV
IRHGTDLSTFTYVWCATRPSDPASATPGVDYVPSSRKVEFGPGVTEQYCTLTILDDTQYP
VIEGLETFVVFLSSAQGAELTKPFQAVIAINDTFQDVPSMQFAKDLLLVKEKEGVLHVPI
TRSGDLSYESSVRCYTQSHSAQVMEDFEERRNADSSRITFLKGDKVKNCTVYIHDDSMFE
PEEQFRVYLGLPLGNHWSGARIGKNNMATITISNDEDAPTIEFEEAAYQVREPAGPDAIA
ILNIKVIRRGDQNRTSKVRCSTRDGSAQSGVDYYPKSRVLKFSPGVDHIFFKVEILSNED
REWHESFSLVLGPDDPVEAVLGDVTTATVTILDQEAAGSLILPAPPIVVTLADYDHVEEV
TKEGVKKSPSPGYPLVCVTPCDPHFPRYAVMKERCSEAGINQTSVQFSWEVAAPTDGNGA
RSPFETITDNTPFTSVNHMVLDSIYFSRRFHVRCVAKAVDKVGHVGTPLRSNIVTIGTDS
AICHTPVVAGTSRGFQAQSFIATLKYLDVKHKEHPNRIHISVQIPHQDGMLPLISTMPLH
NLHFLLSESIYRHQHVCSNLVTTYDLRGISEAGFLDDVVYDSTALGPGYDRPFQFDRSVR
EPKTIQLYKHLNLKSCVWTFDAYYDMTELIDVCGGSVTADFQVRDSAQSFLTVHVPLYVS
YIYVTAPRGWASLEHHTEMEFSFFYDTVLWRTGIQTDSVLSARLQIIRIYIREDGRLVIE
FKTHAKFRGQFVMEHHTLPDVKSFILTPDHLGGIEFDLQLLWSAQTFDSPHQLWRATSSY
NRKDYSGEYTIYLIPCTVQPTQPWVDPGEKPLACTAHAPERFLIPIAFQQTNRPVPVVYS
LNTEFQLCNNEKVFLMDPNTSDMSLAEMDYKGAFSKGQILYGRVLWNPEQNLNSAYKLQL
EKVYLCTGKDGYVPFFDPTGTIYNEGPQYGCIQPNKHLKHRFLLLDRNQPEVTDKYFHDV
PFEAHFASELPDFHVVSSMPGVDGFTLKVDALYKVEAGHQWYLQVIYIIGPDTVSGPRVQ
RSLTAPLRRNRRDLVEPNGQLTLDDSLIYDNEGDQVKNGTNMKSLNLEMQEPAVAASLSQ
TGASIGSALAAIMLLLLVFLVACFINRKCQKQGKKKPAEDILEEYPLNTKVEVPKRHPDR
VEKNVNRQYCTVRNINILSEPEAAYTFKGAKVKRLNLEVRVHNNLQDGTEV
Download sequence
Identical sequences ENSNLEP00000010151 ENSNLEP00000010151

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]