SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000010158 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000010158
Domain Number 1 Region: 1848-2035
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.64e-38
Family Ankyrin repeat 0.0000274
Further Details:      
 
Domain Number 2 Region: 1146-1288
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000628
Family Growth factor receptor domain 0.0095
Further Details:      
 
Domain Number 3 Region: 389-511
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000392
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 4 Region: 268-436
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000014
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 5 Region: 733-774
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000177
Family EGF-type module 0.0049
Further Details:      
 
Domain Number 6 Region: 507-549
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000023
Family EGF-type module 0.005
Further Details:      
 
Domain Number 7 Region: 608-736
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000345
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 8 Region: 832-963
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000502
Family Growth factor receptor domain 0.0098
Further Details:      
 
Domain Number 9 Region: 582-620
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000474
Family EGF-type module 0.0088
Further Details:      
 
Domain Number 10 Region: 121-166
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000559
Family EGF-type module 0.0082
Further Details:      
 
Domain Number 11 Region: 956-1077
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000113
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 12 Region: 1122-1157
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000328
Family EGF-type module 0.011
Further Details:      
 
Domain Number 13 Region: 544-586
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000357
Family EGF-type module 0.0075
Further Details:      
 
Domain Number 14 Region: 770-803
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000786
Family EGF-type module 0.018
Further Details:      
 
Domain Number 15 Region: 157-196
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000132
Family EGF-type module 0.0054
Further Details:      
 
Domain Number 16 Region: 199-241
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000195
Family EGF-type module 0.0087
Further Details:      
 
Domain Number 17 Region: 237-280
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000297
Family EGF-type module 0.021
Further Details:      
 
Domain Number 18 Region: 84-120
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000679
Family EGF-type module 0.026
Further Details:      
 
Domain Number 19 Region: 1284-1328
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000697
Family EGF-type module 0.014
Further Details:      
 
Domain Number 20 Region: 1465-1498
Classification Level Classification E-value
Superfamily Notch domain 0.000000115
Family Notch domain 0.0052
Further Details:      
 
Domain Number 21 Region: 1505-1537
Classification Level Classification E-value
Superfamily Notch domain 0.000000183
Family Notch domain 0.0043
Further Details:      
 
Domain Number 22 Region: 40-80
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000328
Family EGF-type module 0.015
Further Details:      
 
Domain Number 23 Region: 1367-1404
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000129
Family EGF-type module 0.02
Further Details:      
 
Domain Number 24 Region: 1424-1456
Classification Level Classification E-value
Superfamily Notch domain 0.00000196
Family Notch domain 0.00017
Further Details:      
 
Domain Number 25 Region: 1087-1125
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000304
Family EGF-type module 0.021
Further Details:      
 
Domain Number 26 Region: 1321-1361
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000135
Family EGF-type module 0.02
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000010158
Domain Number - Region: 7-38
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00312
Family EGF-type module 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000010158   Gene: ENSNLEG00000008342   Transcript: ENSNLET00000010658
Sequence length 2531
Comment pep:known_by_projection supercontig:Nleu1.0:GL397473.1:180246:229163:-1 gene:ENSNLEG00000008342 transcript:ENSNLET00000010658 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GPRCSQPGETCLNGGKCEAANGTEACVCGGAFVGPRCQDPNPCLSTPCKNAGTCHVLDRG
GVADYACSCPLGFSGPLCLTPLDNACLTNPCRNGGTCDLLTLTEYKCRCPPGWSGKSCQQ
ADPCASNPCANGGQCLPFEASYICHCPPSFHGPTCRQDVNECGQNPGLCRHGGTCHNEVG
SYRCVCRATHTGPNCERPYVPCSPSPCQNGGTCRPTGDVTHECACLPGFTGQNCEENIDD
CPGNNCKNGGACVDGVNTYNCRCPPEWTGTYCTEDVDECQLMPNACQNGGTCHNTHGGYN
CVCVNGWTGEDCSENIDDCASAACFHGATCHDRVASFYCECPHGRTGLLCHLNDACISNP
CNEGSNCDTNPVNGKAICTCPSGYTGPACQDVDECSLGANPCEHAGKCINTLGSFECQCL
QGYTGPRCEIDVNECVSNPCQNDATCLDQIGEFQCICMPGYEGVHCEVNTDECASSPCLH
NGRCLDKINEFQCECPTGFTGHLCQYDVDECASTPCKNGAKCLDGPNTYTCVCTEGYTGT
HCEVDIDECDPDPCHYGSCKDGVATFTCLCRPGYTGHHCETNINECSSQPCRHGGTCQDR
DNAYLCFCLKGTTGPNCEINLDDCASSPCDSGTCLDKIDGYECACEPGYTGDMCNINIDE
CAGNPCHNGGTCEDGINGFTCRCPEGYHDPTCLSEVNECNSNPCVHGACRDSLNGYKCNC
DPGWSGTNCDINNNECESNPCVNGGTCKDMTSGYVCTCREGFSGPNCQTNINECASNPCL
NQGTCIDDVAGYKCNCLLPYTGEGALGPCSPGVTCNGGECRGSEDYESFSCVCPTGWQGQ
TCEVDINECVLSPCRHGASCQNTHGGYRCHCQAGYSGRNCETDIDDCRPNPCHNGGSCTD
GINTAFCDCLPGFQGTFCEEDINECASDPCHNGANCTDCVDSYTCTCPAGFSGIHCENNT
PDCTESSCFNGGTCMDGINSFTCLCPPGFTGSYCQHDVNECDSQPCLHGGTCQDGCGSYR
CTCPQGYTGPNCQNLVHWCDSSPCKNGGKCWQTHTQYRCECPSGWTGLYCDVPSVSCEVA
AQRQGVDVARLCQHGGLCVDTGNTHHCRCQAGYTGSYCEDLVDECSPSPCQNGATCTDYL
GGYSCKCVAGYHGVNCSEEIDECLSHPCQNGGTCLDLPNTYKCSCPRGTQGVHCEINLDD
CNPLVDPVSRSPKCFNNGTCVDQVGGYSCTCPPGFVGERCEGDVNECLSNPCDARGTQNC
VQRVNDFHCECRAGHTGRRCESVINGCKGKPCKNGGTCAVASNTARGFICKCPAGFEGAT
CENDARTCGRLRCLNGGTCISGPRSPTCLCLGPFTGPECQFPASSPCLGGNPCYNQGTCE
PTSESPFYRCLCPAKFNGLLCHILDYSFGGGAGRDIPPPQIEEACELPECQEDAGNKVCS
LQCNNHACGWDGGDCSLNFNDPWKNCTQSLQCWKYFSDGHCDSQCNSAGCLFDGFDCQRA
EGQCNPLYDQYCKDHFSDGHCDQGCNSAECEWDGLDCAEHVPERLAAGTLVVVVLMPPEQ
LRNSSFHFLRELSRVLHTNVVFKRDAHGQQMIFPYYGREEELHKHPIKRAAEGWAAPDAL
LGQVKASLLPGGSGGGRRRRELDPMDVRGSIVYLEIDNRQCVQASSQCFQSATDVAAFLG
ALASLGSLNIPYKIEAVQSETVEPPPPAQLHFMYVAAAAFVLLFFVGCGVLLSRKRRRQH
GQLWFPEGFKVSEASKKKRREPLGEDSVGLKPLKNASDGALMDDNQNEWGDEDLETKKFR
FEEPVVLPDPDDQTDHRQWTQQHLDAADLRMSAMAPTPPQGEVDADCMDVNVRGPDGFTP
LMIASCSGGGLETGNSEEEEDAPAVISDFIYQGASLHNQTDRTGETALHLAARYSRSDAA
KRLLEASADANIQDNMGRTPLHAAVSADAQGVFQILIRNRATDLDARMHDGTTPLILAAR
LAVEGMLEDLINSHADVNAVDDLGKSALHWAAAVNNVDAAVVLLKNGANKDMQNNKVSAR
LGCKGRGLNPQRSAGQTHGAQGHKGLTHRVLRVAGPACRPHLHGVGHLLNVLALLQPLFT
EPFQVQVQLSGHGGSPHRPGPTLLGGTRTRVAAAPCGVGPLGVFAKAKDLEARRKKSQDS
ASPRPVTSGMLSPVDSLESPHGYLSDVASPPLLPSPFQQSPSVPLNHLPGMPDTHLGIGH
LNVVAKPEMAALGGGGRLAFETGPPRLSHLPVASGTSTVLGSSSGGAMNFTVGGSTSLNG
QCEWLSRLQSGMVPNQYNPLRGSVAPGPLSTQAPSLQHGMVGPLHSSLAASALSQMMSYQ
GLPSTRLATQPHLVQTQQVQPQNLQMQQQNLQPPNIQQQQQSLQPPPPPPQPHLGVSSAA
SSHLGRSFLGGDPSQADVQPLGPSSLAVHTILPQESPALPTSLPSSLVPPVTAAQFLTPP
SQHSYSSSPVDNTPSHQLQVPEHPFLTPSPESPDQWSSSSPHSNVSDWSEGVSSPPTSMQ
SQIARIPEAFK
Download sequence
Identical sequences ENSNLEP00000010158 ENSNLEP00000010158

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]