SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000010165 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000010165
Domain Number 1 Region: 1868-2055
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.99e-38
Family Ankyrin repeat 0.0000274
Further Details:      
 
Domain Number 2 Region: 1166-1308
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000769
Family Growth factor receptor domain 0.0095
Further Details:      
 
Domain Number 3 Region: 405-527
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000267
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 4 Region: 523-565
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000304
Family EGF-type module 0.005
Further Details:      
 
Domain Number 5 Region: 624-752
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000298
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 6 Region: 749-790
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000304
Family EGF-type module 0.0049
Further Details:      
 
Domain Number 7 Region: 852-983
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000314
Family Growth factor receptor domain 0.0098
Further Details:      
 
Domain Number 8 Region: 982-1097
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000408
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 9 Region: 137-182
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000479
Family EGF-type module 0.0082
Further Details:      
 
Domain Number 10 Region: 1142-1177
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000274
Family EGF-type module 0.011
Further Details:      
 
Domain Number 11 Region: 560-602
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000286
Family EGF-type module 0.0075
Further Details:      
 
Domain Number 12 Region: 786-819
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000768
Family EGF-type module 0.018
Further Details:      
 
Domain Number 13 Region: 598-636
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000837
Family EGF-type module 0.0088
Further Details:      
 
Domain Number 14 Region: 173-212
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000102
Family EGF-type module 0.0054
Further Details:      
 
Domain Number 15 Region: 291-329
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000167
Family EGF-type module 0.0069
Further Details:      
 
Domain Number 16 Region: 253-300
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000167
Family EGF-type module 0.016
Further Details:      
 
Domain Number 17 Region: 100-136
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000042
Family EGF-type module 0.026
Further Details:      
 
Domain Number 18 Region: 1304-1348
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000554
Family EGF-type module 0.014
Further Details:      
 
Domain Number 19 Region: 1485-1518
Classification Level Classification E-value
Superfamily Notch domain 0.0000000915
Family Notch domain 0.0052
Further Details:      
 
Domain Number 20 Region: 328-368
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000123
Family EGF-type module 0.0063
Further Details:      
 
Domain Number 21 Region: 1525-1557
Classification Level Classification E-value
Superfamily Notch domain 0.000000144
Family Notch domain 0.0043
Further Details:      
 
Domain Number 22 Region: 56-96
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000187
Family EGF-type module 0.015
Further Details:      
 
Domain Number 23 Region: 215-257
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000197
Family EGF-type module 0.0087
Further Details:      
 
Domain Number 24 Region: 1387-1424
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000101
Family EGF-type module 0.02
Further Details:      
 
Domain Number 25 Region: 1444-1476
Classification Level Classification E-value
Superfamily Notch domain 0.00000157
Family Notch domain 0.00017
Further Details:      
 
Domain Number 26 Region: 1107-1145
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000025
Family EGF-type module 0.021
Further Details:      
 
Domain Number 27 Region: 1341-1381
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000226
Family EGF-type module 0.02
Further Details:      
 
Domain Number 28 Region: 370-407
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000232
Family EGF-type module 0.049
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000010165
Domain Number - Region: 23-54
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00229
Family EGF-type module 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000010165   Gene: ENSNLEG00000008342   Transcript: ENSNLET00000010664
Sequence length 2056
Comment pep:known_by_projection supercontig:Nleu1.0:GL397473.1:181895:270270:-1 gene:ENSNLEG00000008342 transcript:ENSNLET00000010664 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LAPLLCVSPPPVLPCLGPRCSQPGETCLNGGKCEAANGTEACVCGGAFVGPRCQDPNPCL
STPCKNAGTCHVLDRGGVADYACSCPLGFSGPLCLTPLDNACLTNPCRNGGTCDLLTLTE
YKCRCPPGWSGKSCQQADPCASNPCANGGQCLPFEASYICHCPPSFHGPTCRQDVNECGQ
NPGLCRHGGTCHNEVGSYRCVCRATHTGPNCERPYVPCSPSPCQNGGTCRPTGDVTHECA
CLPGFTGQNCEENIDDCPGNNCKNGGACVDGVNTYNCRCPPEWTGQYCTEDVDECQLMPN
ACQNGGTCHNTHGGYNCVCVNGWTGEDCSENIDDCASAACFHGATCHDRVASFYCECPHG
RTGLLCHLNDACISNPCNEGSNCDTNPVNGKAICTCPSGYTGPACQDVDECSLGANPCEH
AGKCINTLGSFECQCLQGYTGPRCEIDVNECVSNPCQNDATCLDQIGEFQCICMPGYEGV
HCEVNTDECASSPCLHNGRCLDKINEFQCECPTGFTGHLCQYDVDECASTPCKNGAKCLD
GPNTYTCVCTEGYTGTHCEVDIDECDPDPCHYGSCKDGVATFTCLCRPGYTGHHCETNIN
ECSSQPCRHGGTCQDRDNAYLCFCLKGTTGPNCEINLDDCASSPCDSGTCLDKIDGYECA
CEPGYTGSMCNINIDECAGNPCHNGGTCEDGINGFTCRCPEGYHDPTCLSEVNECNSNPC
VHGACRDSLNGYKCNCDPGWSGTNCDINNNECESNPCVNGGTCKDMTSGYVCTCREGFSG
PNCQTNINECASNPCLNQGTCIDDVAGYKCNCLLPYTGEGWVEPMLEGXXXXXLQNGGEC
RGSEDYESFSCVCPTGWQGQTCEVDINECVLSPCRHGASCQNTHGGYRCHCQAGYSGRNC
ETDIDDCRPNPCHNGGSCTDGINTAFCDCLPGFQGTFCEEDINECASDPCHNGANCTDCV
DSYTCTCPAGFSGIHCENNTPDCTESSCFNGGTCMDGINSFTCLCPPGFTGSYCQHDVNE
CDSQPCLHGGTCQDGCGSYRCTCPQGYTGPNCQNLVHWCDSSPCKNGGKCWQTHTQYRCE
CPSGWTGLYCDVPSVSCEVAAQRQGVDVARLCQHGGLCVDTGNTHHCRCQAGYTGSYCED
LVDECSPSPCQNGATCTDYLGGYSCKCVAGYHGVNCSEEIDECLSHPCQNGGTCLDLPNT
YKCSCPRGTQGVHCEINLDDCNPLVDPVSRSPKCFNNGTCVDQVGGYSCTCPPGFVGERC
EGDVNECLSNPCDARGTQNCVQRVNDFHCECRAGHTGRRCESVINGCKGKPCKNGGTCAV
ASNTARGFICKCPAGFEGATCENDARTCGRLRCLNGGTCISGPRSPTCLCLGPFTGPECQ
FPASSPCLGGNPCYNQGTCEPTSESPFYRCLCPAKFNGLLCHILDYSFGGGAGRDIPPPQ
IEEACELPECQEDAGNKVCSLQCNNHACGWDGGDCSLNFNDPWKNCTQSLQCWKYFSDGH
CDSQCNSAGCLFDGFDCQRAEGQCNPLYDQYCKDHFSDGHCDQGCNSAECEWDGLDCAEH
VPERLAAGTLVVVVLMPPEQLRNSSFHFLRELSRVLHTNVVFKRDAHGQQMIFPYYGREE
ELHKHPIKRAAEGWAAPDALLGQVKASLLPGGSGGGRRRRELDPMDVRGSIVYLEIDNRQ
CVQASSQCFQSATDVAAFLGALASLGSLNIPYKIEAVQSETVEPPPPAQLHFMYVAAAAF
VLLFFVGCGVLLSRKRRRQHGQLWFPEGFKVSEASKKKRREPLGEDSVGLKPLKNASDGA
LMDDNQNEWGDEDLETKKFRFEEPVVLPDPDDQTDHRQWTQQHLDAADLRMSAMAPTPPQ
GEVDADCMDVNVRGPDGFTPLMIASCSGGGLETGNSEEEEDAPAVISDFIYQGASLHNQT
DRTGETALHLAARYSRSDAAKRLLEASADANIQDNMGRTPLHAAVSADAQGVFQILIRNR
ATDLDARMHDGTTPLILAARLAVEGMLEDLINSHADVNAVDDLGKSALHWAAAVNNVDAA
VVLLKNGANKDMQNNK
Download sequence
Identical sequences ENSNLEP00000010165

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]