SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000010168 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000010168
Domain Number 1 Region: 531-832
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.84e-84
Family Protein kinases, catalytic subunit 0.0000000000861
Further Details:      
 
Domain Number 2 Region: 1-172
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 8.93e-76
Family Ephrin receptor ligand binding domain 0.0000000144
Further Details:      
 
Domain Number 3 Region: 301-505
Classification Level Classification E-value
Superfamily Fibronectin type III 1.61e-23
Family Fibronectin type III 0.00043
Further Details:      
 
Domain Number 4 Region: 828-902
Classification Level Classification E-value
Superfamily SAM/Pointed domain 3.93e-21
Family SAM (sterile alpha motif) domain 0.0000281
Further Details:      
 
Domain Number 5 Region: 230-301,339-359
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000294
Family Growth factor receptor domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000010168   Gene: ENSNLEG00000008335   Transcript: ENSNLET00000010668
Sequence length 904
Comment pep:known_by_projection supercontig:Nleu1.0:GL397339.1:3865029:3990517:1 gene:ENSNLEG00000008335 transcript:ENSNLET00000010668 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSTTATGELGWMVHPPSGWEEVSGYDENMNTIRTYQVCNVFESSQNNWLRTKFIRRRGA
HRIHVEMKFSVRDCSSIPSVPGSCKETFNLYYYEADFDSATKTFPNWMENPWVKVDTIAA
DESFSQVDLGGRVMKINTEVRSFGPVSRSGFYLAFQDYGGCMSLIAVRVFYRKCPRIIQN
GAIFQETLSGAESTSLVAARGSCIANAEEVDVPIKLYCNGDGEWLVPIGRCMCKAGFEAV
ENGTVCRGCPSGTFKANQGDEACTHCPINSRTTSEGATNCVCRNGYYRADLDPLDMPCTT
IPSAPQAVISSVNETSLMLEWTPPRDSGGREDLVYNIICKSCGSGRGACTRCGDNVQYAP
RQLGLTEPRIYISDLLAHTQYTFEIQAVNGVTDQSPFSPQFASVNITTNQAGGSEASGTS
QSREKESDTESHETRWSCSGCFLNTSLMFIDYELSEYNATAIKSPTNTVTVQGLKAGAIY
VFQVRARTVAGYGRYSGKMYFQTMTEVTPGMKIYIDPFTYEDPNEAVREFAKEIDISCVK
IEQVIGAGEFGEVCSGHLKLPGKREIFVAIKTLKSGYTEKQRRDFLSEASIMGQFDHPNV
IHLEGVVTKSTPVMIITEFMENGSLDSFLRQNDGQFTVIQLVGMLRGIAAGMKYLADMNY
VHRDLAARNILVNSNLVCKVSDFGLSRFLEDDTSDPTYTSALGGKIPIRWTAPEAIQYRK
FTSASDVWSYGIVMWEVMSYGERPYWDMTNQDVINAIEQDYRLPPPMDCPSALHQLMLDC
WQKDRNHRPKFGQIVNTLDKMIRNPNSLKAMAPLSSGINLPLLDRTIPDYTSFNTVDEWL
EAIKMGQYKESFANAGFTSFDVVSQMMMEDILRVGVTLAGHQKKILNSIQVMRAQMNQIQ
SVEV
Download sequence
Identical sequences ENSNLEP00000010168

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]