SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000010174 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000010174
Domain Number 1 Region: 561-693,747-920
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.26e-81
Family Protein kinases, catalytic subunit 0.0000000000485
Further Details:      
 
Domain Number 2 Region: 212-310
Classification Level Classification E-value
Superfamily Immunoglobulin 2.24e-16
Family V set domains (antibody variable domain-like) 0.057
Further Details:      
 
Domain Number 3 Region: 316-415
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000156
Family I set domains 0.048
Further Details:      
 
Domain Number 4 Region: 426-520
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000192
Family C1 set domains (antibody constant domain-like) 0.083
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000010174
Domain Number - Region: 34-117
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000705
Family V set domains (antibody variable domain-like) 0.091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000010174   Gene: ENSNLEG00000008295   Transcript: ENSNLET00000010675
Sequence length 973
Comment pep:known_by_projection supercontig:Nleu1.0:GL397316.1:2987034:3069276:1 gene:ENSNLEG00000008295 transcript:ENSNLET00000010675 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRGARGAWDFLCVLLLLLRVQTGSSQPSVSPGEPSPPSIHPAKSELIVRVGDEIRLLCTD
PGFVKWTFEILDETNENKQNEWIREKAEATNTGKYTCTNKHGLSSSIYVFVRDPAKLFLV
DRSLYGKEDNDTLVRCPLTDPEVTNYSLKGCQGKPLPKDLRFVPDPKAGIMIKSVKRTYH
RLCLHCSVDQEGKSVLSEKFILKVRPAFKAVPVVSVSKASYLLREGEEFTVTCTIKDVSS
SVYSTWKRENSQQTKLQEKYNSWHHGDFNYERQATLTISSARVNDSGVFMCYANNTFGSA
NVTTALEVVDKGFINIFPMINTTVFVNDGENVDLIVEYEAFPKPEHQQWIYMNRTFTDKW
EDYPKSENESNIRYVSELHLTRLKGTEGGTYTFLVSNSDVSASIAFNVYVNTKPEILTYD
RLVNGMLQCVAAGFPEPTIDWYFCPGTEQRCSASVLPVDVQTLNSSGPPFGKLVVQSSID
SSAFKHNGTVECKAYNDVGKTSAYFNFAFKEQIHPHTLFTPLLIGFVIVAGMMCIIVMIL
TYKYLQKPMYEVQWKVVEEINGNNYVYIDPTQLPYDHKWEFPRNRLSFGKTLGAGAFGKV
VEATAYGLIKSDAAMTVAVKMLKPSAHLTEREALMSELKVLSYLGNHMNIVNLLGACTIG
GPTLVITEYCCYGDLLNFLRRKRDSFICSKQEDHAEAALYKNLLHSKESSCSDSTNEYMD
MKPGVSYVVPTKADKRRSARIGSYIERDVTPAIMEDDELALDLEDLLSFSYQVAKGMAFL
ASKNCIHRDLAARNILLTHGRITKICDFGLARDIKNDSNYVVKGNARLPVKWMAPESIFN
CVYTFESDVWSYGIFLWELFSLGSSPYPGMPVDSKFYKMIKEGFRMLSPEHAPAEMYDIM
KTCWDADPLKRPTFKQIVQLIEKQISESTNHIYSNLANCSPNRQKPVVDHSVRINSVGST
ASSSQPLLVHDDV
Download sequence
Identical sequences XP_003268433.2.23891 ENSNLEP00000010174

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]