SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000010216 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000010216
Domain Number 1 Region: 846-1047
Classification Level Classification E-value
Superfamily Fibronectin type III 2.63e-38
Family Fibronectin type III 0.0011
Further Details:      
 
Domain Number 2 Region: 643-837
Classification Level Classification E-value
Superfamily Fibronectin type III 2.64e-33
Family Fibronectin type III 0.00000241
Further Details:      
 
Domain Number 3 Region: 355-452
Classification Level Classification E-value
Superfamily Immunoglobulin 4.29e-19
Family I set domains 0.012
Further Details:      
 
Domain Number 4 Region: 543-638
Classification Level Classification E-value
Superfamily Immunoglobulin 4.68e-19
Family I set domains 0.01
Further Details:      
 
Domain Number 5 Region: 275-365
Classification Level Classification E-value
Superfamily Immunoglobulin 3.89e-18
Family I set domains 0.019
Further Details:      
 
Domain Number 6 Region: 450-549
Classification Level Classification E-value
Superfamily Immunoglobulin 5.05e-17
Family I set domains 0.027
Further Details:      
 
Domain Number 7 Region: 42-132
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000177
Family I set domains 0.014
Further Details:      
 
Domain Number 8 Region: 147-228
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000504
Family I set domains 0.032
Further Details:      
 
Domain Number 9 Region: 1066-1142
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000565
Family Fibronectin type III 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000010216   Gene: ENSNLEG00000008311   Transcript: ENSNLET00000010718
Sequence length 1302
Comment pep:known_by_projection supercontig:Nleu1.0:GL397314.1:1487677:1578471:1 gene:ENSNLEG00000008311 transcript:ENSNLET00000010718 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQLKIMPKKKRLSAGRVPLILFLCQMISALEVPLDRKYHVVQPPTITQQSPKDYIIDPRE
NIVIQCEAKGKPPPSFSWTRNGTHFDIDKDPLVTMKPGTGTLIINIMSEGKAETYEGVYQ
CTARNERGAAVSNNIVVRPSRSPLWTKEKLEPITLQSGQSLVLPCRPPIGLPPPIIFWMD
NSFQRLPQSERVSQGLNGDLYFSNVLPEDTREDYICYARFNHTQTIQQKQPISVKVISVD
ELNDTIAANLSDTEFYGAKSSRERPPTFLTPEGNASNKEELRGNVLSLECIAEGLPTPII
YWAKEDGMLPKNRTVYKNFEKTLQIVHVSEADSGNYQCIAKNALGAIHHTISVRVKAAPY
WITAPQNLVLSPGEDGTLICRANGNPKPRISWLTNGVPIEIAPDDPSRKIDGDTIIFSNV
QERSSAVYQCNASNEYGYLLANAFVNVLAEPPRILTPANTLYQVIANRPALLDCAFFGSP
LPTIEWFKGAKGSALHEDIYVLHENGTLEIPVAQKDSTGTYTCVARNKLGMAKNEVHLEI
KDPTWIVKQPEYAVVQRGSMVSFECKVKHDHTLTLTVLWLKDNRELPSDERFTVDRDHLV
VADVSDEDSGTYTCVANTTLDSVSASAVLSVVAPTPTPAPVYDVPNPPFDLELTDQLDKS
VQLSWTPGDDNNSPITKFIIEYEDAMHEPGLWHHQTEVSGTQTTAQLKLSPYVNYSFRVM
AVNGIGKSLPSEASEQYLTKASEPDKNPTAVEGLGSEPDNLVITWKPLNGFESNGPGLQY
KVSWRQKDGDDEWTSVVVANVSKYIVSGTPTFVPYLIKVQALNDMGFAPEPAVVTGHSGE
DLPMVAPGNVRVNVVNSTLAEVHWDPVPLKSIRGHLQGYRIYYWKTQSSSKRNRRHIEKK
ILTFQGSKTHGMLPGLEPFSHYTLNVRVVNGKGEGPASPDRVFNTPEGVPSAPSSLKIVN
PTLDSLTLEWDPPSHPNGILTEYTLKYQPINSTHELGPLVDLKIPANKTRWTLKNLNFST
RYKFYFYAQTSAGSGSQITEEAVTTVDEAGILPPDVGAGKVQAVNPRISNLTAAAAETYA
NISWEYEGPEHVNFYVEYGVAGSKEEWRKEIVNGSRSFFGLKGLMPGTAYKVRVGAVGDS
GFVSSEDVFETGPAMASRQVDIATQGWFIGLMCAVALLILILLIVCFIRRNKGGKYPVKE
KEDAHADPEIQPMKEDDGTFGEYSDAEDHKPLKKGSRTPSDRTVKKEDSDDSLVDYGEGV
NGQFNEDGSFIGQYSGKKEKEPAEGNESSEAPSPVNAMNSFV
Download sequence
Identical sequences ENSNLEP00000010216 ENSNLEP00000010216

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]