SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000010220 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000010220
Domain Number 1 Region: 179-577,658-663,694-736
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.86e-95
Family FAD-linked reductases, N-terminal domain 0.000000000000724
Further Details:      
 
Domain Number 2 Region: 562-670
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 1.5e-30
Family L-aminoacid/polyamine oxidase 0.000000845
Further Details:      
 
Domain Number 3 Region: 74-180
Classification Level Classification E-value
Superfamily Homeodomain-like 1.52e-30
Family SWIRM domain 0.00000121
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000010220   Gene: ENSNLEG00000008363   Transcript: ENSNLET00000010722
Sequence length 759
Comment pep:known_by_projection supercontig:Nleu1.0:GL397339.1:4074131:4127310:1 gene:ENSNLEG00000008363 transcript:ENSNLET00000010722 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VEYREMDESLANLSEDEYYSEEERNAKAEKEKKLPPPPPQAPPEEENESEPEEPSGQAGG
LQDDSSGGYGDGQASGVEGAAFQSRLPHDRMTSQEAACFPDIISGPQQTQKVFLFIRNRT
LQLWLDNPKIQLTFEATLQQLEAPYNSDTVLVHRVHSYLERHGLINFGIYKRIKPLPTKK
TGKVIIIGSGVSGLAAARQLQSFGMDVTLLEARDRVGGRVATFRKGNYVADLGAMVVTGL
GGNPMAVVSKQVNMELAKIKQKCPLYEANGQAERIIVPKEKDEMVEQEFNRLLEATSYLS
HQLDFNVLNNKPVSLGQALEVVIQLQEKHVKDEQIEHWKKIVKTQEELKELLNKMVSLKE
KIKELHQQYKEASEVKPPRDITAEFLVKSKHRDLTALCKEYDELAETQGKLEEKLQELEA
NPPSDVYLSSRDRQILDWHFANLEFANATPLSTLSLKHWDQDDDFEFTGSHLTVRNGYSC
VPVALAEGLDIKLNTAVRQVRYTASGCEVIAVNTRSTSQTFIYKCDAVLCTLPLGVLKQQ
PPAVQFVPPLPEWKTSAVQRMGFGNLNKVVLCFDRVFWDPSVNLFGHVGSTTASRGELFL
FWNLYKAPILLALVAGEAAGIMENISDDVIVGRCLAILKGIFGSSAVPQPKETVVSRWRA
DPWARGSYSYVAAGSSGNDYDLMAQPITPGPSIPGAPQPIPRLFFAGEHTIRNYPATVHG
ALLSGLREAGRIADQFLGAMYTLPRQATPGVPAQQSPSM
Download sequence
Identical sequences ENSNLEP00000010220 ENSNLEP00000010220

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]