SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000010261 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000010261
Domain Number 1 Region: 28-132
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000497
Family V set domains (antibody variable domain-like) 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000010261   Gene: ENSNLEG00000008434   Transcript: ENSNLET00000010765
Sequence length 307
Comment pep:known_by_projection supercontig:Nleu1.0:GL397372.1:4218718:4245308:1 gene:ENSNLEG00000008434 transcript:ENSNLET00000010765 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMGIFLVYVGFVFFSVLYVQQGLSSQAKFTEFPRNVTATEGQNVEMSCAFQSGSASVYLE
IQWWFLRGPEDLEPGAEGAGAQVAEPADPASPPAIFQTVKVQGNDISHKLQISKVRKKDE
GLYECRVTDANYGELQEHKAQCEFKVNANSHARRMQAFEASPMWLQDMKPRKNVSAAVPS
SIHGSANQPTHSTSSPQAVAKIPKQSPQSVSPILPEVKHLHRPPLLVLPFFSLSSLFSTD
PLPTFPTSHTTVKQLPAPLPQPGHGSTPGVQSCVLAPPAKSKSPVKSTERTAKLTLNSKH
HPAPTVL
Download sequence
Identical sequences ENSNLEP00000010261 ENSNLEP00000010261

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]