SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000010267 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000010267
Domain Number 1 Region: 146-734
Classification Level Classification E-value
Superfamily Heme-dependent peroxidases 2.47e-194
Family Myeloperoxidase-like 0.0000000000814
Further Details:      
 
Domain Number 2 Region: 741-797
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000005
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 3 Region: 794-844
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000019
Family EGF-type module 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000010267   Gene: ENSNLEG00000008418   Transcript: ENSNLET00000010772
Sequence length 916
Comment pep:known_by_projection supercontig:Nleu1.0:GL397445.1:1085132:1199366:1 gene:ENSNLEG00000008418 transcript:ENSNLET00000010772 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRALAVLSVTLVMACTEAFFPFISRGKELLWGKPEESPVASILEESKRLVDTAMYATMQR
NLKKRGILSPAQLLSFSKLPEPTSRVIARAAEIMQTSIQAMKRNVNLKTQQSQHPTDALS
EDLLSIIANMSGCLPYMLPPKCPNTCLANKYRLITGACSNRDHPRWGASNTALARWLPPV
YEDGFSQPRGWNPGFLYNGFPLPPVREVTRHVIQVSNEVVTDDDRYSDLLMAWGQYIDHD
ITFTPQSTSKAAFGGGADCQMTCENQNPCFPIQLPEEARPAAGAACLPFYRSSAACGTGD
QGALFGNLSVANPRQQMNGLTSFLDASTVYGSSPALERQLRNWTSAEGLLRVHARLRDSG
RAYLPFAPPRAPAACAPEPGIPGETRGPCFLAGDGRASEVPSLTALHTLWLREHNRLAAA
LKTLNAHWSADAVYQEARKVVGALHQIITLRDYIPRILGPEAFQQYVGPYEGYDSTANPT
VSNVFSTAAFRFGHATIHPMVRRLDASFQEHPDLPGLWLHEAFFSPWTLLRGGGLDPLIR
GLLARPAKLQVQDQLMNEELTERLFVLSNSSTLDLASINLQRGRDHGLPGYNEWREFCGL
PRLETPADLSTAIASRSVADKILDLYKHPDNIDVWLGGLAENFLPRARTGPLFACLIGKQ
MKALRDGDWFWWENSHIFTDAQRRELEKHSLSRVICDNTGLTRVPVDAFQVGKFPEDFES
CDSIPGMNLEAWRETFPQDDKCGFPESVENGDFVHCEESGRRVLVYSCRHGYELQGQEQL
TCTQEGWDFQPPLCKDVNECADGAHPPCHASARCRNTKGGFQCLCADPYELGDDGRTCID
SGRLPRATWVSISLAALLIGGLAGLTSTVICRWESAGMEAGILTGCREPSEGKVAGHIRT
ASCSQNHLTTVFQTQA
Download sequence
Identical sequences ENSNLEP00000010267

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]