SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000010295 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000010295
Domain Number 1 Region: 669-1248
Classification Level Classification E-value
Superfamily Heme-dependent peroxidases 1.11e-202
Family Myeloperoxidase-like 0.000000000595
Further Details:      
 
Domain Number 2 Region: 1-133
Classification Level Classification E-value
Superfamily L domain-like 3.06e-34
Family Ngr ectodomain-like 0.0082
Further Details:      
 
Domain Number 3 Region: 276-370
Classification Level Classification E-value
Superfamily Immunoglobulin 1.87e-26
Family I set domains 0.011
Further Details:      
 
Domain Number 4 Region: 363-455
Classification Level Classification E-value
Superfamily Immunoglobulin 8.75e-25
Family I set domains 0.0077
Further Details:      
 
Domain Number 5 Region: 461-549
Classification Level Classification E-value
Superfamily Immunoglobulin 1.67e-24
Family I set domains 0.036
Further Details:      
 
Domain Number 6 Region: 179-273
Classification Level Classification E-value
Superfamily Immunoglobulin 1.68e-22
Family I set domains 0.012
Further Details:      
 
Domain Number 7 Region: 1348-1406
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000178
Family VWC domain 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000010295   Gene: ENSNLEG00000008442   Transcript: ENSNLET00000010801
Sequence length 1413
Comment pep:known_by_projection supercontig:Nleu1.0:GL397445.1:1285732:1345831:-1 gene:ENSNLEG00000008442 transcript:ENSNLET00000010801 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DLRFNRIREIQPGAFRRLRNLNTLLLNNNQIKRIPSGAFEDLENLKYLYLYKNEIQSIDR
QAFKGLASLEQLYLHFNQIETLDPDSFQQLPKLERLFLHNNRITHLVPGTFNHLESMKRF
LFSGRVLLCCPGWSAVARSQLTAAAASRAQASCAPAHGGKGDSGREASSVSIFWLGTERP
RITSEPQDADVTSGNTVYFTCRAEGNPKPEIIWLRNNNELSMKTDSRLNLLDDGTLMIQN
TQETDQGIYQCMAKNVAGEVKTHEVTLRYFGSPARPTFVIQPQNTEVLVGESVTLECSAT
GHPPPRISWTRGDRTPLPVDPRVNITPSGGLYIQNVVQEDSGEYACSATNNLDSVHATAF
IIVQALPQFTVTPQDRVVIEGQTVDFQCEAKGNPPPVIAWTKGGSQLSVDRRHLVLSSGT
LRISGVALHDQGQYECQAVNIIGSQKVVAHLTVQPRVTPVFASIPSDTTVEVGANVQLPC
SSQGEPEPAITWNKDGVQVTESGKFHISPEGFLTINDVGPADAGRYECVARNTIGSASVS
MVLSVNVPDVSRNGDPFVATSIVEAIATVDRAINSTRTHLFDSRPRSPNDLLALFRYPRD
PYTVEQARAGEIFERTLQLIQEHVQHGLMVDLNGTSYHYNDLVSPQYLNLIANLSGCTAH
RRVNNCSDMCFHQKYRTHDGTCNNLQHPMWGASLTAFERLLKSVYENGFNTPRGINPHRL
YNGHALPMPRLVSTTLIGTETVTPDEQFTHMLMQWGQFLDHDLDSTVVALSQARFSDGQH
CSSVCSNDPPCFSVTIPSNDSRARSGARCMFFVRSSPVCGSGMTSLLMNSVYPREQINQL
TSYIDASNVYGSTEHEARSIRDLASHRGLLRQGIVQRSGKPLLPFATGPPTECMRDENES
PIPCFLAGDHRANEQLGLTSMHTLWFREHNRIATELLKLNPHWDGDTIYYETRKIVGAEI
QHITYQHWLPKILGEVGMRTLGEYQGYDPGINAGIFNAFATAAFRFGHTLVNPLLYRLDE
NFQPIAQGHLPLHKAFFSPFRIVNEGGIDPLLRGLFGVAGKMRVPSQLLNTELTERLFSM
AHTVALDLAAINIQRGRDHGIPPYHDYRVYCNLSAAHTFEDLKNEIKNPEIREKLQRLYG
STLNIDLFPALMVEDLVPGSRLGPTLMCLLSTQFKRLRDGDRLWYENPGVFSPAQLTQIK
QTSLARILCDNADNITRVQSDVFRVAEFPHGYGSCDEIPRVDLRVWQDCCEDCRTRGQFN
AFSYHFRGRRSLEFSYQEDKPTKKTRPRKVPSVGRQGEYLSNNTSAFSTRSDAPGTNDFR
EFVLEMQKTITDLRTQIKKLESRLSTTECVDAGGESHANNTKWKKDACTVCECKDGQVTC
FVEACPPATCAVPVNIPGACCPVCLQKRAEEKP
Download sequence
Identical sequences ENSNLEP00000010295 ENSNLEP00000010295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]