SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000010298 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000010298
Domain Number 1 Region: 815-942,986-1160
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.3e-77
Family Protein kinases, catalytic subunit 0.000000000103
Further Details:      
 
Domain Number 2 Region: 665-752
Classification Level Classification E-value
Superfamily Immunoglobulin 2.61e-20
Family I set domains 0.0098
Further Details:      
 
Domain Number 3 Region: 339-452
Classification Level Classification E-value
Superfamily Immunoglobulin 2.88e-18
Family I set domains 0.019
Further Details:      
 
Domain Number 4 Region: 227-330
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000286
Family I set domains 0.052
Further Details:      
 
Domain Number 5 Region: 556-662
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000328
Family I set domains 0.097
Further Details:      
 
Domain Number 6 Region: 432-460,493-545
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000592
Family V set domains (antibody variable domain-like) 0.075
Further Details:      
 
Domain Number 7 Region: 114-218
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000757
Family I set domains 0.0019
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000010298
Domain Number - Region: 32-106
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000145
Family I set domains 0.096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000010298   Gene: ENSNLEG00000008365   Transcript: ENSNLET00000010804
Sequence length 1356
Comment pep:known_by_projection supercontig:Nleu1.0:GL397316.1:3417586:3464888:-1 gene:ENSNLEG00000008365 transcript:ENSNLET00000010804 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESKVLLAVALWLCVETWAASVGLPSVSLDLPRLSIQKDILTIKANTTLQITCRGQRDLD
WLWPNNQSGSEQRVEVTECSDGLFCKTLTIPRVIGNDTGAYKCFYRETDLASVIYVYVQD
YRSPFIASVSDQHGVVYITENKNKTVVIPCLGSISNLNVSLCARYPEKRFVPDGNRISWD
SKKGFTIPSYMISYAGMVFCEAKINDESYQSIMYIVVVVGYRIYDVVLSPSHGVELSVGE
KLVLNCTARTELNVGIDFNWEYPSLKHQHKKLVNRDLKTQSGSEMKKFLSTLTIDGVTRS
DQGLYTCAASSGLMTRKNSTFVRVHEKPFVAFGSGMESLVEATVGERVRIPVKYLGYPPP
EIKWYKNGIPLESNHTIKAGHVLTIMEVSERDTGNYTVILTNPISKEKQSHVVSLVVYVP
PQIGEKSLISPVDSYQYGTTQTLTCTVYAIPPPHHIHWYWQLEEECPNEPSQAVSVTNPY
PCEEWRSVEDFQGGNKIEVNNNQFALIEGKNKTVSTLVIQVANVSALYKCEAVNKVGRGE
RVISFHVTRGPEITLQPDMQPTEQESVSLWCAADRSTFENLTWYKLGPQPLPIHMGELPT
PVCKNLDTLWKLNATMFSNSTNDILIMELKNASLQDQGDYVCLAQDRKTKKRHCVVRQLT
VLERVAPMITGNLENQTTSIGESIEVSCTASGNPSPQIMWFKDNETLVEDSGIVLKDGNR
NLTIRRVRKEDEGLYTCQACSVLGCAKVEAFFIIEGAQEKTNLEIIILVGTAVIAMFFWL
LLVIILRTVKRANGGELKTGYLSIVMDPDELPLDEHCERLPYDASKWEFPRDRLKLGKPL
GRGAFGQVIEADAFGIDKTATCRTVAVKMLKEGATHSEHRALMSELKILIHIGHHLNVVN
LLGACTKPGGPLMVIVEFCKFGNLSTYLRSKRNEFVPYKTKGARFRQGKDYVGTIPVDLK
RRLDSITSSQSSASSGFVEEKSLSDVEEEEAPEDLYKDFLTLEHLICYSFQVAKGMEFLA
SRKCIHRDLAARNILLSEKNVVKICDFGLARDIYKDPDYVRKGDARLPLKWMAPETIFDR
VYTIQSDVWSFGVLLWEIFSLGASPYPGVKIDEEFCRRLKEGTRMRAPDYTTPEMYQTML
DCWHGEPSQRPTFSELVEHLGNLLQANAQQDGKDYIVLPISETLSMEEDSGLSLPTSPVS
CMEEEEVCDPKFHYDNTAGISQYLQNSKRKSRPVSVKTFEDIPLEEPEVKVIPDDNQTDS
GMVLASEELKTLEDRTKLAPSFSGMVPSKSRESVASEGSNQTSGYQSGYHSDDTDTTVYS
SEEAELLKLIEIGVQTGSTSQILQPDSGTTLSSPPV
Download sequence
Identical sequences G1RAQ1
XP_003268434.1.23891 ENSNLEP00000010298 ENSNLEP00000010298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]