SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000010336 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000010336
Domain Number 1 Region: 196-316
Classification Level Classification E-value
Superfamily EF-hand 3.53e-35
Family Osteonectin 0.023
Further Details:      
 
Domain Number 2 Region: 285-380
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 1.96e-27
Family Thyroglobulin type-1 domain 0.00085
Further Details:      
 
Domain Number 3 Region: 134-181
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000018
Family Ovomucoid domain III-like 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000010336   Gene: ENSNLEG00000008485   Transcript: ENSNLET00000010843
Sequence length 439
Comment pep:known_by_projection supercontig:Nleu1.0:GL397305.1:4378050:4891176:-1 gene:ENSNLEG00000008485 transcript:ENSNLET00000010843 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPAIAVLAAAAAAWCFLQVESRHLDALAGGAGPNHGNFLDNDQWLSTVSQYDRDKYWNRF
RDVSTGATRPWGAPWRSPFSPCKTEALKVKCSPHKVCVTQDYQTALCVSRKHLLPRQKKG
NVAHKHWVGPSNLVKCKPCPVAQSAMVCGSDGHSYTSKCKLEFHACSTGKSLTTLCDGPC
PCLPEPEPPKHKAERNACTDKELRNLASRLKDWFGALHEDANRVIKPTSSNTAQGRFDTS
ILPICKDSLGWMFNKLDMNYDLLLDHSEINAIYLDKYEPCIKPLFNSCDSFKDGKLSNNE
WCYCFQKPGGLPCQNEMNRIQKLSKGKSLLGAFIPRCNEEGYYKATQCHGSTGQCWCVDK
YGNELAGSRKQGAVSCEEEQETSGDFGSGGSVVLLDDLEDERELGPKDKEGKLRVHTRAV
TEDDEDEDDDKEDEVGYIW
Download sequence
Identical sequences ENSNLEP00000010336 ENSNLEP00000010336

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]