SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000010401 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000010401
Domain Number 1 Region: 51-256
Classification Level Classification E-value
Superfamily L domain-like 7.65e-42
Family Ngr ectodomain-like 0.0015
Further Details:      
 
Domain Number 2 Region: 1875-1968
Classification Level Classification E-value
Superfamily Immunoglobulin 9.23e-21
Family I set domains 0.013
Further Details:      
 
Domain Number 3 Region: 1971-2070
Classification Level Classification E-value
Superfamily Immunoglobulin 4.89e-20
Family I set domains 0.038
Further Details:      
 
Domain Number 4 Region: 2379-2463
Classification Level Classification E-value
Superfamily Immunoglobulin 1.21e-19
Family I set domains 0.012
Further Details:      
 
Domain Number 5 Region: 2068-2162
Classification Level Classification E-value
Superfamily Immunoglobulin 5.27e-19
Family I set domains 0.011
Further Details:      
 
Domain Number 6 Region: 2563-2656
Classification Level Classification E-value
Superfamily Immunoglobulin 4.63e-18
Family I set domains 0.036
Further Details:      
 
Domain Number 7 Region: 2754-2850
Classification Level Classification E-value
Superfamily Immunoglobulin 5.44e-18
Family I set domains 0.02
Further Details:      
 
Domain Number 8 Region: 2170-2265
Classification Level Classification E-value
Superfamily Immunoglobulin 5.93e-17
Family I set domains 0.034
Further Details:      
 
Domain Number 9 Region: 616-694
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000134
Family I set domains 0.024
Further Details:      
 
Domain Number 10 Region: 2273-2370
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000187
Family I set domains 0.067
Further Details:      
 
Domain Number 11 Region: 511-600
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000103
Family V set domains (antibody variable domain-like) 0.019
Further Details:      
 
Domain Number 12 Region: 2479-2558
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000568
Family V set domains (antibody variable domain-like) 0.055
Further Details:      
 
Domain Number 13 Region: 2669-2755
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000306
Family I set domains 0.086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000010401   Gene: ENSNLEG00000008532   Transcript: ENSNLET00000010910
Sequence length 2851
Comment pep:known_by_projection supercontig:Nleu1.0:GL397281.1:932467:995382:-1 gene:ENSNLEG00000008532 transcript:ENSNLET00000010910 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLPAHRSRVRRLPKDRCPRIRHPDKMPKRAHWGALSVVLILLWGHPRVALACPHPCACYV
PSEVHCTFRSLASVPAGIAKHVERINLGFNSIQALAETSFAGLTKLELLMIHGNEIPSIP
DGALRDLSSLQVFKFSYNKLRVITGQTLQGLSNLMRLHIDHNKIEFIHPQAFNGLMSLRL
LHLEGNLLHQLHPSTFSTFTFLDHFRLSTIRHLYLAENMIRTLPASMLQNMPLLENLYLQ
GNPWTCDCEMRWFLEWDAKSRGILKCKKDKAYEGGQLCAMCFSPKKLYKHEIHKLKDLTC
LKPSIESPLRQNRSRSIEEEQEPEEDGDSQLILEKFQLPQWSVSLNMTDEHGNMVNLVCD
IKKPMDVYKIHLNQTDPPDIDINATVALDFECPMTRENYEKLWKLIAYYSEVPVKLHREL
MLSKDPRVSYQYRQDADEEALYYTGVRAQILAEPEWVMQPSIDIQLNRRQSTAKKVLLSC
YTQYSQTISTKDTRQARGRSWVMIEPSRAVQRDQTVLEGGPCQLSCNVKASESPSIFWVL
PDGSILKAPMDDPDSKFSILSSGWLRIKSMEPSDSGLYQCIAQVRDEMDRMVYRVLVQSP
STQPAEKDTVTIGKNPGEPVTLPCNALAIPEAHLSWILPNRRIINDLANTSHVYMLPNGT
LSIPKVQVSDSGYYRCVAVNQQGADHFTVGITVTKKGSGSPSKRGRRPGAKALSRVREDI
VEDEGGSGMGDEENTSRRLLHPKDQEVFLKTKDDAINGDKKAKKGRRKLKLWKHSEKEPE
TNVAEGRRVFESRRRINMANKQINPERWADILAKVRGKNLPKGTEVPPVIKTTSPPSLSL
EVTPPLPAVSPPSASPVQTVTSAEESSADVPLLGEEEHVLGTISSASMGLEHHNNGVILV
EPEVTSTPLEEVVDELSEKTEEITSTEGDLKGTAAPTLISEPYEPSPTLHTLDTVYEEPI
HEETATEGWSAADVGSSPEPTSSEYEPPLDAVSLAKSEPVQYFDPDLETKSQPDEDKMKD
TFAHLTPTPTVWVNDSSTSQSFEESTSEKAGIEEDHYSQCLVEDICLVSSVIGSQNTLLI
KKGMKEMSQTPQGGNMLEGDPTHSRSSESEGQESKSITLPDSTLGIMSSTSPVKKPTETT
VGTLLDKDTTTATTPRQKVAPSSTVSTHPSRRRPNGRRRLRPNKFRHRHKQIPPTTFAPS
ETFSTQPTQAPDIKISNQVESSLVPTAWVDNTVNTPKQLEMEKNAEPISKGTPWRKHGKR
PNKHRYTPSTVSSKASGSKPSPSPENKHRNIVTPSSETILLPRNVSLKTEGPYGSLDYMT
TTTKIYSSYPKVQETLPVTYKPTSDGKEIKDDVATNVDKHKSDILVTGESITNVIPTSRS
LVSTMGEFKEESAPIGFPGTPTWNPSRTAQPGRLQTDIPVTTSGENLTDPPLLKELEVVD
FTSEFSSSVTVSTPFHQEEAGSSTTLSSIKVEVASSQAETTTLDRDHHETTVAILHSETR
PQNHTPTAARMKEPASLSPPTILVSLGQTTTTKPALPSPRISQASRDSKKNVFLNYVGNP
ETEATPVNNEGTQHMSGPNELSTPSSDQDAFNLSTKLELEKQVFNSRSLPRGPDSHHQDE
RVHASHQLTRAPAKPILPTATVRLPEMSTESASRYFVTSQSPRHWTNKPEITTYPSRTLP
ENKQFTTPRLASTTTPLPLHMSKPSISSKFTDRRTAQSNGYSKVFGNNNIPEARNPVGKP
PRPRIPHYSNGSFPFFTNKTLSFPQLGVTRRPQIPTSPAPVTRERKVTPGSYNTIHAHST
FHLDFGPPAPPLLHTPRTTGSPSTNLQNIPVVSSTQSSVSFITSSIQSSGSFHQSSSKFF
AGGPPASKFWSLGEKPQILTKSPQTVSVTAETDAVFPCEAAGKPKPFVTWTKVSTGALMT
PNTRIQRFEVLKNGTLVIRKVQVQDRGQYMCTASNLHGLDRMVVLLSVTMQQPQILASHY
QDVTVYLGDTIAMECLAKGTPAPQISWIFPDRRVWQTVSPVEGRITLHENRTLSIKEASF
SDRGVYKCVASNAAGADSLAIRLHVAALPPVIHQEKLENISLPPGLSIHIHCTAKAAPLP
SVRWVLGDGTQIRPSQFLHGNLFVFPNGTLYIRNLAPKDSGRYECVAANLVGSARRTVQL
NVQRAAANARITGTSPRRTDVRYGGTLKLDCSASGDPWPRILWRLPSKRMIDVLFSFDSR
IKVFANGTLVVKSVTDKDAGDYLCVARNKVGDDYVVLKVDVVMKPAKIEHKEENDHKVFY
GGDLKVDCVATGLPNPEISWSLPDGSLVNSFMQSDDSGGRTKRYVVFNNGTLYFNEVGMR
EEGDYTCFAENQVGKDEMRVRVKVVTAPATIRNKTYLAVQVPYGDVVTVACEAKGEPMPK
VTWLSPTNKVIPISSEKYQIYQDGTLLIQKAQRSDSGNYTCLVRNGAGEDRKTVWIHVNV
QPPKINGNPNPITTVREIAAGGSRKLIDCRAEGIPTPRVLWAFPEGVVLPAPYYGNRVTV
HGNGSLDIRSLRKSDSVQLVCMARNEGGEARLIVQLTVLEPMEKPIFHDPISEKITAMAG
HTISLNCSAAGTPTPSLVWVLPNGTDLQSGQQLQRFYHKADGMLHISGLSSVDAGAYRCV
ARNAAGHTERLVSLKVGLKPEANKQYHNLVSIINGETLKLPCTPPGAGQGRFSWTLPSGM
HLEGPQTLGRVSLLDNGTLTVREASVFDRGTYVCRMETEYGPSVTSIPVIVIAYPPRITS
EPTPVIYTRPGNSVKLNCMAMGIPKADITWELPDKSHLKAGVQARLYGNRFLHPQGSLTI
QHATQRDAGFYKCMAKNILGSDSKTTYIHVF
Download sequence
Identical sequences ENSNLEP00000010401

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]